DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrnb1l

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001233249.1 Gene:chrnb1l ZFINID:ZDB-GENE-060811-1 Length:486 Species:Danio rerio

Alignment Length:513 Identity:95/514 (18%)
Similarity:179/514 (35%) Gaps:165/514 (32%)


  Fly   176 LVINY-LSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSI 239
            |.||| ::.|...|...|...:..|..|..::.|   ..|..|:::..:.:..            
Zfish     4 LNINYDINGSRKASEAERRLLEDLFQDYNLKVRP---ARTWNERVMVRVGMTL------------ 53

  Fly   240 SFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGAL 304
                 .:.::..|.:..:.|.:.|.|.|.|.||.|.|||:..::....|.:::|:|.:.::|   
Zfish    54 -----VQLISLNQKNGEMTTNVFMNMEWTDYRLSWNPEDYDKIDVVRIPPVKVWRPDIYLIN--- 110

  Fly   305 QSMGQVLQSYELMVYAN------GSIT-----LYAQNLQLA------SW--CVDSARNWPSERVT 350
            .:.||    :::.:|.|      |:::     :|..:..:.      .|  |....|::..:...
Zfish   111 NNDGQ----FDVALYVNVLVRSDGTVSWLPPAIYRSSCSIEVAYFPFDWQNCSMVFRSYTYDSSE 171

  Fly   351 CDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSG-WSFTQMSVVLVENDSQRRYNPKGMMQ 414
            .|::.||: ::|.|...::.|         |:..|.:| |...            .:.:.|.:..
Zfish   172 VDLQYGLD-EDGNELHEIVID---------ENAFTENGEWQIC------------HKPSRKNVQD 214

  Fly   415 KMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLIL-IALLIAAWGLMYMT 478
            .:..|:.....::|...||:....:|.|...:..|..|.|.......:.| |::|||....|.:.
Zfish   215 DLYEDITFYLIIERKPLFYVINIIVPCILTSVLAIFVFYLPPGAGEKMTLSISVLIALTVFMLLL 279

  Fly   479 RYASPH---YVPPMMTAYKVIMMTTTYCYILHICIIWLDLY---PPRSKAPGWLVRVINSNVLRC 537
            ....|.   .:|.::......|:..|:..||.:.:  |:|:   |.....||| ||.:..|:|..
Zfish   280 ADKVPETSLAIPIIVNYVMFTMILVTFSVILSVVV--LNLHHRTPSTHHMPGW-VRKVFINLLPR 341

  Fly   538 ILGL---------------------------------------------------------RFSD 545
            .||:                                                         |||:
Zfish   342 YLGVLRPTPEEPVEEEPKENVPMGCLGNSLRPGGEYFIRKINPELVMPWRGSHNESTVKLQRFSN 406

  Fly   546 STDYC---------------------------DIQENPWHHMAKILNNLSS-ILVIIT 575
            |.:||                           |...:.|.::|.:|:.|.. :.|:||
Zfish   407 SDNYCLILPPNLKSAIAAITYMSEQLKKQDVDDTMTDDWQYIAVVLDRLFLWLFVVIT 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 6/16 (38%)
Neur_chan_LBD 212..429 CDD:280998 40/237 (17%)
chrnb1lNP_001233249.1 LIC 11..473 CDD:273305 91/507 (18%)
Neur_chan_LBD 20..230 CDD:280998 44/259 (17%)
Neur_chan_memb 237..472 CDD:280999 43/232 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.