DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrnb5a

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_009289434.1 Gene:chrnb5a ZFINID:ZDB-GENE-090312-169 Length:494 Species:Danio rerio

Alignment Length:366 Identity:72/367 (20%)
Similarity:132/367 (36%) Gaps:99/367 (27%)


  Fly   198 GFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMH 262
            |.:.|...|.|.|   .|::::...:.:..      |.|.|::           :...::.|.:.
Zfish    38 GPERYNKLIRPAV---NKSQQVTIGIKVSL------AQLISVN-----------EREQIMTTNVW 82

  Fly   263 MMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLY 327
            :...|.|.||||.|.::..::....|...||.|.:.:.|.|       ...||:..|.|..::..
Zfish    83 LTQEWNDYRLVWDPNEYEGIKKLRIPSRHIWLPDIVLYNNA-------DGVYEVSFYCNAVVSNT 140

  Fly   328 AQNLQL-----ASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPS 387
            .....|     .|.|....||:|.::..|.::.                               .
Zfish   141 GDIFWLPPAIYKSACAIEVRNFPFDQQNCTLKF-------------------------------R 174

  Fly   388 GWSF--TQMSVVLVENDSQR-RYNPKGM--MQKMTG------------DVAIEFTLQRNRSFYMT 435
            .|::  |::.:.|..:.:.| .|.|.|.  :..:.|            ||..:|.::|...||..
Zfish   175 SWTYDRTELDLYLTSDFASRDDYTPSGEWDIVSLPGRRNEDLSDPTYLDVTYDFVIKRKPLFYTI 239

  Fly   436 VFYLPLIACQMFLILSFVLRST--RRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVI-- 496
            ...:|.:......||.|.|.|.  .:.:|.:..||.....|:.:::     .|||...|..:|  
Zfish   240 NLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISK-----IVPPTSLAVPLIGK 299

  Fly   497 -----MMTTTYCYILHICIIWLDLY---PPRSKAPGWLVRV 529
                 |:..|:..:..:|:  |:::   |...:.|.|:.||
Zfish   300 YLMFTMVLVTFSIVTSVCV--LNVHHRSPSTHRMPEWVKRV 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 41/239 (17%)
chrnb5aXP_009289434.1 Neur_chan_LBD 20..474 CDD:332142 72/367 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.