DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fal and AT5G40290

Sequence 1:NP_001137974.1 Gene:fal FlyBaseID:FBgn0028380 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_198845.1 Gene:AT5G40290 AraportID:AT5G40290 Length:448 Species:Arabidopsis thaliana

Alignment Length:309 Identity:88/310 (28%)
Similarity:152/310 (49%) Gaps:35/310 (11%)


  Fly     3 IEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLG----LLPWAIDKKADHKRYDHCLGAYKSAQD 63
            :.|.|||.|.|.....:.::...||||:.:.|||    :.|.|:     |.|::|.||.|..|.:
plant    23 VHDNVHGNIYLDPLCLKFIDTEQFQRLRELKQLGVTNMVYPGAV-----HSRFEHSLGVYWLAGE 82

  Fly    64 HLRAIERNSHYEPKLPDWCRQAVEIAALLHDIGHGPMSHAWE------LVTHHEFDHEENAMACV 122
            .::.::.....|..:.:...|.|.:|.|||||||||.||.:|      :::..::.||..::..:
plant    83 TVQRLKTFQGMELGIDNHDLQTVRLAGLLHDIGHGPFSHMFEREFLPKVISGCQWSHELMSINMI 147

  Fly   123 DKIFKDALNQELVSLRDDGGGRGVQLIKALILGSSENLPFPMLGHT---YIFDIVHNRRCGLDVD 184
            |.|        :.:...|...:.::.:|.:||.|:|  ...:.|:.   :::|||.|.|.|:|||
plant   148 DYI--------VDTHHIDVDAKMLKRVKDMILASTE--VSELKGNAEKRFLYDIVANGRNGIDVD 202

  Fly   185 KWDYLRRDNKRLKILSSAEMDFDDVFLQARISPDGQRIEYRYADYHRVYRLFEARSLLHVKAYQY 249
            |:||:.||::...:  .....|..:....|:..:  .|.|...:|..|::||..|:.|....|.:
plant   203 KFDYIVRDSRACGL--GCNFQFQRLTEPMRVIDN--EICYPAKEYRTVHKLFATRADLCGTVYMH 263

  Fly   250 PLTCAMDVIFVSVVQRIAPELLSIRS--KDPKWLELTDEYVLNVIEKDP 296
            |...|::::.|..:.: |..:|.|.|  .||......|:.:|..||:.|
plant   264 PKKMAIELMIVDAMVK-ANNVLEISSMINDPSQYWKLDDTILKTIERSP 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
falNP_001137974.1 HDc 48..210 CDD:238032 49/171 (29%)
AT5G40290NP_198845.1 YdhJ 19..434 CDD:224004 88/310 (28%)
HDc 67..215 CDD:238032 48/158 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I2007
OMA 1 1.010
OrthoDB 1 1.010 D835545at2759
OrthoInspector 1 1.000 T124369
orthoMCL 1 0.900 OOG5_127247
Panther 1 1.100 O PTHR11373
Phylome 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.