DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fal and AT5G40270

Sequence 1:NP_001137974.1 Gene:fal FlyBaseID:FBgn0028380 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_568580.1 Gene:AT5G40270 AraportID:AT5G40270 Length:473 Species:Arabidopsis thaliana

Alignment Length:362 Identity:99/363 (27%)
Similarity:165/363 (45%) Gaps:66/363 (18%)


  Fly     3 IEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLG----LLPWAIDKKADHKRYDHCLGAYKSAQD 63
            :.|.|||.|.|.....:.::...||||:.:.|||    :.|.|:     |.|::|.||.|..|.:
plant    30 VYDNVHGNIYLDPLCLKFIDTEQFQRLRELKQLGVTNMVYPGAV-----HSRFEHSLGVYWLAGE 89

  Fly    64 HLRAIERNSHYEPKLPDWCRQAVEIAALLHDIGHGPMSHAWE------LVTHHEFDHEENAMACV 122
            ..:.::.....|..:.::..|.|.:|.|||||||||.||.:|      :::..::.||..::..:
plant    90 TAQRLKNFQGMELGIDNYDLQTVRLAGLLHDIGHGPFSHMFEREFLPKVISDCQWSHELMSVNMI 154

  Fly   123 DKIFKDALNQELVSLRD-DGGGRGVQLIKALILGSSENLPFPML-GHT---YIFDIVHNRRCGLD 182
            |         .:|.... |...:.::.:|.:||.|:|   |..| |:.   :::|||.|.|.|:|
plant   155 D---------HMVDTHHIDIDAQMLKRVKDMILASTE---FSQLKGNAEKRFLYDIVANGRNGID 207

  Fly   183 VDKWDYLRRDNKRLKILSSAEMDFDDVFLQARISPDGQRIEYRYADYHRVYRLFEARSLLHVKAY 247
            |||:|||.||::...:  .:...|..:....|:..:  .|.:|..:|..|::||..|:.|:...|
plant   208 VDKFDYLVRDSRACGL--GSNFQFQRLTETMRVLDN--EICFRAKEYLSVHKLFATRADLYRTVY 268

  Fly   248 QYPLTCAMDVIFVSVVQRIAPEL-LSIRSKDPKWLELTDEYVLNVIE--KDPISRYVKEPHRLVE 309
            .:....|::::.|..:.:....| :|....||......|:.:|..||  .||.....||.     
plant   269 THSKVKAIELMIVDAMVKANNHLEISSMINDPSEYWKLDDTILKTIEIAPDPELAEAKEL----- 328

  Fly   310 VPSNDCSGSDIIRVNRVIPGPWELIKSARELAFFGNK 346
                      |:||.|            |:|..|.|:
plant   329 ----------ILRVRR------------RQLYQFCNE 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
falNP_001137974.1 HDc 48..210 CDD:238032 52/173 (30%)
AT5G40270NP_568580.1 YdhJ 26..449 CDD:224004 99/363 (27%)
HDc 74..222 CDD:238032 51/160 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I2007
OMA 1 1.010
OrthoDB 1 1.010 D835545at2759
OrthoInspector 1 1.000 T124369
orthoMCL 1 0.900 OOG5_127247
Panther 1 1.100 LDO PTHR11373
Phylome 1 0.910 0.964 Consistency score
76.980

Return to query results.
Submit another query.