| Sequence 1: | NP_001137974.1 | Gene: | fal / 43927 | FlyBaseID: | FBgn0028380 | Length: | 368 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009294116.1 | Gene: | LOC793232 / 793232 | -ID: | - | Length: | 527 | Species: | Danio rerio |
| Alignment Length: | 388 | Identity: | 111/388 - (28%) |
|---|---|---|---|
| Similarity: | 181/388 - (46%) | Gaps: | 76/388 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLGLLPWAIDKKADHKRYDHCLGAYKSAQDHLR 66
Fly 67 AIERNSHYEPKL----PDWCRQAVEIAALLHDIGHGPMSHAWELVTHHE---------------- 111
Fly 112 -FDHEENAMACVDKIFKDALNQELVSLRDDG-GGRGVQLIKALILG--SSENLPFPMLGH----T 168
Fly 169 YIFDIVHNRRCGLDVDKWDYLRRDNKRLKILSSAEMDFDDV----FLQARISPDGQRIEYRYADY 229
Fly 230 HRVYRLFEARSLLHVKAYQYPLTCAMDVIFVSVVQRIAPELLSIRSKD-----------PKWLEL 283
Fly 284 TDEYVLNVIEKDPISRYVKEPHRLVEVPSNDCSGSDIIRVNRVIP---GPWEL---IKSAREL 340 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| fal | NP_001137974.1 | HDc | 48..210 | CDD:238032 | 61/193 (32%) |
| LOC793232 | XP_009294116.1 | HDc | 107..286 | CDD:238032 | 61/191 (32%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170573542 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 1 | 1.000 | - | - | H132165 | |
| Inparanoid | 1 | 1.050 | 113 | 1.000 | Inparanoid score | I4827 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D426111at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0002596 | |
| OrthoInspector | 1 | 1.000 | - | - | otm24655 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_100615 | |
| Panther | 1 | 1.100 | - | - | O | PTHR11373 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X1701 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 10 | 9.900 | |||||