DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fal and LOC793232

Sequence 1:NP_001137974.1 Gene:fal FlyBaseID:FBgn0028380 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_009294116.1 Gene:LOC793232 ID: Length:527 Species:Danio rerio

Alignment Length:388 Identity:111/389 (29%)
Similarity:181/389 (47%) Gaps:76/389 (20%)


  Fly     2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLGLLPWAIDKKADHKRYDHCLGAYKSAQDHLR 66
            :..|.:||.|.|...:.:|.:.|.||||:|:.||| ..:.:...|.|.|::|.:|....|...::
Zfish    62 IFNDPIHGHIALHPLLVKITDTPQFQRLRHLKQLG-GTYLVYPGASHNRFEHSIGVAYLAGRLVK 125

  Fly    67 AIERNSHYEPKL----PDWCRQAVEIAALLHDIGHGPMSHAWELVTHHE---------------- 111
            ::..|   :|:|    .|:.  .|:||.|.||:||||:||.::.:...|                
Zfish   126 SLHDN---QPELKITKQDFL--CVQIAGLCHDLGHGPLSHVFDALVIPEAKKIKTRKGLPDDIPE 185

  Fly   112 -FDHEENAMACVDKIFKDALNQELVSLRDDG-GGRGVQLIKALILG--SSENLPFPMLGH----T 168
             :.||:.::...|.|.| :||:|:  ||:.| ....|..||.||.|  :|:| .:|..|.    :
Zfish   186 SWKHEQMSVLMFDSIVK-SLNEEV--LREHGLTDNDVIFIKELIEGAKASDN-EWPYKGRNVEKS 246

  Fly   169 YIFDIVHNRRCGLDVDKWDYLRRDNKRLKILSSAEMDFDDV----FLQARISPDGQRIEYRYADY 229
            ::::||.|::.|:|||||||..||...|.|.:|    ||.:    |.:..:....:.|.:|..:.
Zfish   247 FLYEIVANKQNGIDVDKWDYFARDCHHLGIRNS----FDHLRLLKFARVCVVNGRKHICFRDKEA 307

  Fly   230 HRVYRLFEARSLLHVKAYQYPLTCAMDVIFVSVVQRIAPELLSIRSKD-----------PKWLEL 283
            ..||.:|..|..||.:|||:.:...::.:|...:.....:|...|..|           ..:.:|
Zfish   308 DNVYDMFRTRYTLHRQAYQHKIGNIIEDMFAEALLLADRDLHEDRPADMLKISEAIKSVEDYSKL 372

  Fly   284 TDEYVLNVIEKDPISRYVKEPHRLVEVPSNDCSGSDIIRVNRVIP---GPWEL---IKSAREL 340
            |||....::..  .|..:||...:::         .|:|  |.:|   |...|   |||..||
Zfish   373 TDEIFEQILSS--TSPNLKESRDILD---------KIMR--RKLPKFIGETRLTKKIKSMEEL 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
falNP_001137974.1 HDc 48..210 CDD:238032 61/194 (31%)
LOC793232XP_009294116.1 HDc 107..286 CDD:238032 61/192 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C245453020
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H132165
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D426111at33208
OrthoFinder 1 1.000 FOG0002970
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.