DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fal and LOC793232

DIOPT Version :9

Sequence 1:NP_001137974.1 Gene:fal / 43927 FlyBaseID:FBgn0028380 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_009294116.1 Gene:LOC793232 / 793232 -ID:- Length:527 Species:Danio rerio


Alignment Length:388 Identity:111/388 - (28%)
Similarity:181/388 - (46%) Gaps:76/388 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLGLLPWAIDKKADHKRYDHCLGAYKSAQDHLR 66
            :..|.:||.|.|...:.:|.:.|.||||:|:.||| ..:.:...|.|.|::|.:|....|...::
Zfish    62 IFNDPIHGHIALHPLLVKITDTPQFQRLRHLKQLG-GTYLVYPGASHNRFEHSIGVAYLAGRLVK 125

  Fly    67 AIERNSHYEPKL----PDWCRQAVEIAALLHDIGHGPMSHAWELVTHHE---------------- 111
            ::..|   :|:|    .|:.  .|:||.|.||:||||:||.::.:...|                
Zfish   126 SLHDN---QPELKITKQDFL--CVQIAGLCHDLGHGPLSHVFDALVIPEAKKIKTRKGLPDDIPE 185

  Fly   112 -FDHEENAMACVDKIFKDALNQELVSLRDDG-GGRGVQLIKALILG--SSENLPFPMLGH----T 168
             :.||:.::...|.|.| :||:|:  ||:.| ....|..||.||.|  :|:| .:|..|.    :
Zfish   186 SWKHEQMSVLMFDSIVK-SLNEEV--LREHGLTDNDVIFIKELIEGAKASDN-EWPYKGRNVEKS 246

  Fly   169 YIFDIVHNRRCGLDVDKWDYLRRDNKRLKILSSAEMDFDDV----FLQARISPDGQRIEYRYADY 229
            ::::||.|::.|:|||||||..||...|.|.:|    ||.:    |.:..:....:.|.:|..:.
Zfish   247 FLYEIVANKQNGIDVDKWDYFARDCHHLGIRNS----FDHLRLLKFARVCVVNGRKHICFRDKEA 307

  Fly   230 HRVYRLFEARSLLHVKAYQYPLTCAMDVIFVSVVQRIAPELLSIRSKD-----------PKWLEL 283
            ..||.:|..|..||.:|||:.:...::.:|...:.....:|...|..|           ..:.:|
Zfish   308 DNVYDMFRTRYTLHRQAYQHKIGNIIEDMFAEALLLADRDLHEDRPADMLKISEAIKSVEDYSKL 372

  Fly   284 TDEYVLNVIEKDPISRYVKEPHRLVEVPSNDCSGSDIIRVNRVIP---GPWEL---IKSAREL 340
            |||....::..  .|..:||...:::         .|:|  |.:|   |...|   |||..||
Zfish   373 TDEIFEQILSS--TSPNLKESRDILD---------KIMR--RKLPKFIGETRLTKKIKSMEEL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
falNP_001137974.1 HDc 48..210 CDD:238032 61/193 (32%)
LOC793232XP_009294116.1 HDc 107..286 CDD:238032 61/191 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H132165
Inparanoid 1 1.050 113 1.000 Inparanoid score I4827
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D426111at33208
OrthoFinder 1 1.000 - - FOG0002596
OrthoInspector 1 1.000 - - otm24655
orthoMCL 1 0.900 - - OOG6_100615
Panther 1 1.100 - - O PTHR11373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1701
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.