DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fal and zgc:174928

Sequence 1:NP_001137974.1 Gene:fal FlyBaseID:FBgn0028380 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_017211347.1 Gene:zgc:174928 ZFINID:ZDB-GENE-080220-14 Length:529 Species:Danio rerio

Alignment Length:67 Identity:17/68 (25%)
Similarity:27/68 (40%) Gaps:6/68 (9%)


  Fly     3 IEDEVHGVIELSSHIQEIVEHPLFQR---LKHVHQLGLLPWAIDKKADHKRYDHCLG--AYKSAQ 62
            |||.:..:.:|...:..: |..|.:|   |:...|..|......:..|.:..:..|.  .|..||
Zfish    34 IEDFISQICQLKKEVASL-EAKLRERGEKLQPERQDSLCGVRAQRSRDTQNSELSLTLLCYTDAQ 97

  Fly    63 DH 64
            ||
Zfish    98 DH 99

Known Domains:


GeneSequenceDomainRegion External IDIdentity
falNP_001137974.1 HDc 48..210 CDD:238032 6/20 (30%)
zgc:174928XP_017211347.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.