powered by:
Protein Alignment fal and zgc:174928
DIOPT Version :9
| Sequence 1: | NP_001137974.1 |
Gene: | fal / 43927 |
FlyBaseID: | FBgn0028380 |
Length: | 368 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_017211347.1 |
Gene: | zgc:174928 / 792701 |
ZFINID: | ZDB-GENE-080220-14 |
Length: | 529 |
Species: | Danio rerio |
| Alignment Length: | 67 |
Identity: | 17/67 - (25%) |
| Similarity: | 27/67 - (40%) |
Gaps: | 6/67 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3 IEDEVHGVIELSSHIQEIVEHPLFQR---LKHVHQLGLLPWAIDKKADHKRYDHCLG--AYKSAQ 62
|||.:..:.:|...:..: |..|.:| |:...|..|......:..|.:..:..|. .|..||
Zfish 34 IEDFISQICQLKKEVASL-EAKLRERGEKLQPERQDSLCGVRAQRSRDTQNSELSLTLLCYTDAQ 97
Fly 63 DH 64
||
Zfish 98 DH 99
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| fal | NP_001137974.1 |
HDc |
48..210 |
CDD:238032 |
6/19 (32%) |
| zgc:174928 | XP_017211347.1 |
None |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1078 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.