DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fal and LOC572225

Sequence 1:NP_001137974.1 Gene:fal FlyBaseID:FBgn0028380 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_701012.4 Gene:LOC572225 ID: Length:502 Species:Danio rerio

Alignment Length:275 Identity:55/276 (20%)
Similarity:88/276 (32%) Gaps:91/276 (33%)


  Fly     3 IEDEVH----GVIELSS----------------HIQEIVEHPLFQRLKHVHQ---LGLLPWAIDK 44
            ::.|.|    |.:..||                |..|..:|...::...||:   .|..|:    
Zfish   243 VKKEFHCELCGKVSFSSGNLKTHMKTHTKEKPFHCSECDKHFSTKQSMMVHKRIHTGERPY---- 303

  Fly    45 KADHKRYDHCLGAYKSA---QDHLRAIERNSHYEPKLPDWCRQAVE-----IAALLHDIGHGPMS 101
                 :..||:..::..   :.|:|     ||...: |..|.:..:     |..:.|...|....
Zfish   304 -----KCPHCVKTFRDGSHFKTHMR-----SHASER-PYQCSECGKTFKQPICLISHQKIHSEKM 357

  Fly   102 H-------AWELVTH---HEFDHE-ENAMAC--VDKIFKDALNQELVSLRDDGG---------GR 144
            |       .:..:.|   ||..|. |....|  ..|.|.|..:.. |..|...|         ||
Zfish   358 HQCLQCDKRFRQIAHLKRHERMHSGEKPYLCFHCGKSFSDPAHFR-VHQRVHTGERPYHCSVCGR 421

  Fly   145 G----VQLIKALILGSSENLPFPMLGHTYIF---DI--VHNR--------RCGLDVDKWDYL--- 189
            .    ..|:|...:.:.|. ||.......:|   |:  :|.|        .|.:..:::.||   
Zfish   422 SFRQHTNLLKHKRIHTGER-PFKCSHCDKMFARSDVLKIHERVHTGEKPYHCSICGERFAYLGGF 485

  Fly   190 -RRDNKRLKILSSAE 203
             ...||.:|...:||
Zfish   486 QTHQNKHVKEQPAAE 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
falNP_001137974.1 HDc 48..210 CDD:238032 43/208 (21%)
LOC572225XP_701012.4 COG5048 174..>477 CDD:227381 48/251 (19%)
C2H2 Zn finger 193..213 CDD:275368
C2H2 Zn finger 221..241 CDD:275368
C2H2 Zn finger 249..269 CDD:275368 3/20 (15%)
zf-H2C2_2 261..286 CDD:290200 3/25 (12%)
C2H2 Zn finger 277..297 CDD:275368 4/20 (20%)
C2H2 Zn finger 305..325 CDD:275368 5/25 (20%)
C2H2 Zn finger 333..353 CDD:275368 3/20 (15%)
C2H2 Zn finger 360..380 CDD:275368 3/20 (15%)
zf-H2C2_2 372..396 CDD:290200 8/24 (33%)
C2H2 Zn finger 388..408 CDD:275368 6/21 (29%)
zf-H2C2_2 400..425 CDD:290200 5/26 (19%)
C2H2 Zn finger 416..436 CDD:275368 4/20 (20%)
zf-H2C2_2 428..453 CDD:290200 6/26 (23%)
C2H2 Zn finger 444..464 CDD:275368 4/20 (20%)
zf-H2C2_2 457..481 CDD:290200 3/24 (13%)
C2H2 Zn finger 472..492 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I4713
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.963 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.