DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fal and Samhd1

Sequence 1:NP_001137974.1 Gene:fal FlyBaseID:FBgn0028380 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_061339.4 Gene:Samhd1 MGIID:1927468 Length:627 Species:Mus musculus

Alignment Length:350 Identity:95/350 (27%)
Similarity:158/350 (45%) Gaps:74/350 (21%)


  Fly     2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLG----LLPWAIDKKADHKRYDHCLGAYKSAQ 62
            :..|.:||.||....:..|::.|.||||:::.|||    :.|     .|.|.|::|.||....|.
Mouse   118 VFNDPIHGHIEFHPLLIRIIDTPQFQRLRYIKQLGGGYYVFP-----GASHNRFEHSLGVGYLAG 177

  Fly    63 DHLRAIERNSHYEPKLPDWCRQ--AVEIAALLHDIGHGPMSHAWE------LVTHHEFDHEENAM 119
            ..:||:   :..:|:|....|.  .|:||.|.||:||||.||.::      .....::.||:.::
Mouse   178 CLVRAL---AEKQPELQISERDILCVQIAGLCHDLGHGPFSHMFDGRFIPRARPEKKWKHEQGSI 239

  Fly   120 ACVDKIFKDALNQELVSLRDDGGG----RGVQLIKALILGS-----SENLPFPMLGH----TYIF 171
                ::|:..:|...:.|.....|    ..:..||..|:|.     .::| :|..|.    ::::
Mouse   240 ----EMFEHLVNSNELKLVMKNYGLVPEEDITFIKEQIMGPPITPVKDSL-WPYKGRPATKSFLY 299

  Fly   172 DIVHNRRCGLDVDKWDYLRRDNKRLKILSSAEMDFDDVFLQARISPDGQRIEYRYAD---YHR-- 231
            :||.|:|.|:|||||||..||...|.|.::  .|:......|||.    .:||:..:   |.|  
Mouse   300 EIVSNKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFIKFARIC----EVEYKVKEDKTYIRKV 358

  Fly   232 ------------VYRLFEARSLLHVKAYQYPLTCAMDVIFVSVVQRIAP--ELLSIRSKD----- 277
                        :|.:|..|:.||.:|||:.::..:|::......:..|  |:.....|.     
Mouse   359 KHICSREKEVGNLYDMFHTRNCLHRRAYQHKISNLIDIMITDAFLKADPYVEITGTAGKKFRIST 423

  Fly   278 -----PKWLELTDEYVLNVIEK-DP 296
                 ..:.:|||...|.|:.. ||
Mouse   424 AIDDMEAFTKLTDNIFLEVLHSTDP 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
falNP_001137974.1 HDc 48..210 CDD:238032 53/183 (29%)
Samhd1NP_061339.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C245462443
eggNOG 1 0.900 E1_COG1078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6883
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002970
OrthoInspector 1 1.000 T1085098
orthoMCL 1 0.900 OOG5_127247
Panther 1 1.100 LDO PTHR11373
Phylome 1 0.910 0.963 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2947
TreeFam 1 0.960
109.680

Return to query results.
Submit another query.