DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fal and samhd1

Sequence 1:NP_001137974.1 Gene:fal FlyBaseID:FBgn0028380 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001153405.1 Gene:samhd1 ZFINID:ZDB-GENE-090313-386 Length:622 Species:Danio rerio

Alignment Length:449 Identity:106/450 (24%)
Similarity:180/450 (40%) Gaps:140/450 (31%)


  Fly     2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLGLLPWAIDKKADHKRYDHCLGAYKSAQDHLR 66
            :..|.:||.|||...:...::.|.||||:|:.||| ..:.:...|.|.|::|.:|....|...::
Zfish    96 VFNDPIHGHIELHPLLLHFIDTPQFQRLRHIKQLG-GTYLVFPGASHNRFEHSIGVGYLAGCLVK 159

  Fly    67 AI-ERNSH-YEPKLPDWCRQAVEIAALLHDIGHGPMSH--------------AW--ELVTHHEFD 113
            |: ||... :..|....|   |:||.|.||:||||.||              .|  |:.:...||
Zfish   160 ALNERQPELFITKQDILC---VQIAGLCHDLGHGPFSHMFDGMFIPKARPADKWKHEIASVQMFD 221

  Fly   114 H--EENAMACVDKIFKDALNQELVSLRDDGGGRGVQLIKALILGSSENLPFPMLGH----TYIFD 172
            |  |.|.:..|.......|.::|:.:::...|.    :::.:|..|:   :|..|.    :::::
Zfish   222 HLVEVNGLEAVMLHHGMRLPEDLIFIKEQIAGP----LESAVLDQSQ---WPYKGRPVEKSFLYE 279

  Fly   173 IVHNRRCGLDVDKWDYLRRDNKRLKILSSAEMDFDDVFLQARI-SPDGQR-IEYRYADYHRVYRL 235
            :|.|:|.|:|||||||..||...|.|.::  .|:......||: ...|:: |..|..:...:|.:
Zfish   280 VVANKRNGIDVDKWDYFARDCYHLGIQNN--FDYQRFLRFARVCEVKGRKHICTRDKEVGNLYDM 342

  Fly   236 FEARSLLHVKAYQ-------------------------------YPLTCAM----------DVIF 259
            |..|:.||.:|||                               :.::.|:          |.||
Zfish   343 FHTRNCLHRRAYQHKVGNIIETMITEAFLKADPHIQIQGSSGRIFTISSAIEDMEAYSKLTDHIF 407

  Fly   260 VSVVQRIAPELLSIRS----------------------------KDPKWLE-------------- 282
            ..::....|||...|:                            |...|.:              
Zfish   408 EQILYSSGPELSEARAILQNIICRRLYKCVGQTTSETNVDVSQEKLLDWAKELARSKPTGTEGNL 472

  Fly   283 LTDEYVLNVI-------EKDPISR---YVK-EPHRLVEVPSNDCS-------GSDIIRV 323
            :.:::|::||       ||:||:.   |.| :|.:.:::.....|       ...:|||
Zfish   473 IAEDFVVSVIHMDYGMKEKNPINNVHFYCKNDPTKAIKIHKKQVSKLLPERFAEQLIRV 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
falNP_001137974.1 HDc 48..210 CDD:238032 53/186 (28%)
samhd1NP_001153405.1 SAM_HD 22..89 CDD:188907
SAM 23..86 CDD:197735
YdhJ 94..>459 CDD:224004 92/376 (24%)
HDc 139..>242 CDD:214679 32/106 (30%)
Substrate binding. {ECO:0000250|UniProtKB:Q9Y3Z3} 289..295 6/6 (100%)
Substrate binding. {ECO:0000250|UniProtKB:Q9Y3Z3} 350..355 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C245456042
eggNOG 1 0.900 E1_COG1078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I4713
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D426111at33208
OrthoFinder 1 1.000 FOG0002970
OrthoInspector 1 1.000 T597827
orthoMCL 1 0.900 OOG5_127247
Panther 1 1.100 LDO PTHR11373
Phylome 1 0.910 0.960 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2947
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.