DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fal and SAMHD1

Sequence 1:NP_001137974.1 Gene:fal FlyBaseID:FBgn0028380 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_056289.2 Gene:SAMHD1 HGNCID:15925 Length:626 Species:Homo sapiens

Alignment Length:465 Identity:117/466 (25%)
Similarity:182/466 (39%) Gaps:172/466 (37%)


  Fly     2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLG----LLPWAIDKKADHKRYDHCLG------ 56
            :|.|.:||.|||...:..|::.|.||||:::.|||    :.|     .|.|.|::|.||      
Human   117 VINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFP-----GASHNRFEHSLGVGYLAG 176

  Fly    57 ----AYKSAQDHLRAIERNSHYEPKLPDWCRQAVEIAALLHDIGHGPMSHAW----------ELV 107
                |....|..|:..||:.           ..|:||.|.||:||||.||.:          |:.
Human   177 CLVHALGEKQPELQISERDV-----------LCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVK 230

  Fly   108 THHE------FDHEENAMACVDKIFKDALNQELVSLRDDGGGRGVQLIKALILGSSENLP----- 161
            ..||      |:|..|:..     .|..:.|..:...:|     :..||..|:|..|: |     
Human   231 WTHEQGSVMMFEHLINSNG-----IKPVMEQYGLIPEED-----ICFIKEQIVGPLES-PVEDSL 284

  Fly   162 FPMLGH----TYIFDIVHNRRCGLDVDKWDYLRRDNKRLKILSSAEMDFDDVFLQARI-SPDGQ- 220
            :|..|.    :::::||.|:|.|:|||||||..||...|.|.::  .|:......||: ..|.: 
Human   285 WPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFIKFARVCEVDNEL 347

  Fly   221 RIEYRYADYHRVYRLFEARSLLHVKAYQ-------------------------------YPLTCA 254
            ||..|..:...:|.:|..|:.||.:|||                               |.::.|
Human   348 RICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTA 412

  Fly   255 M----------DVIFVSVVQRIAPEL---------------------------LSIRSKD----- 277
            :          |.||:.::....|:|                           :.|:.:|     
Human   413 IDDMEAYTKLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLP 477

  Fly   278 -------PKWL---EL-TDEYVLNVI-------EKDPI---SRYVK-EPHRLVEVPSNDCS---- 316
                   ||.|   :| .::::::||       ||:||   |.|.| .|:|.:.:..|..|    
Human   478 KEVASAKPKVLLDVKLKAEDFIVDVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLP 542

  Fly   317 ---GSDIIRV 323
               ...:|||
Human   543 EKFAEQLIRV 552

Known Domains:


GeneSequenceDomainRegion External IDIdentity
falNP_001137974.1 HDc 48..210 CDD:238032 56/197 (28%)
SAMHD1NP_056289.2 SAM_HD 41..110 CDD:188907
SAM 42..109 CDD:197735
YdhJ 115..504 CDD:224004 103/416 (25%)
HDc 162..335 CDD:238032 56/197 (28%)
Substrate binding. {ECO:0000269|PubMed:24141705} 309..315 6/6 (100%)
Substrate binding. {ECO:0000269|PubMed:24141705} 370..375 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C245457456
eggNOG 1 0.900 E1_COG1078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6883
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D426111at33208
OrthoFinder 1 1.000 FOG0002970
OrthoInspector 1 1.000 T1074994
orthoMCL 1 0.900 OOG5_127247
Panther 1 1.100 LDO PTHR11373
Phylome 1 0.910 0.963 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2947
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.690

Return to query results.
Submit another query.