DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fal and ZK177.8

Sequence 1:NP_001137974.1 Gene:fal FlyBaseID:FBgn0028380 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_495054.1 Gene:ZK177.8 WormBaseID:WBGene00022673 Length:587 Species:Caenorhabditis elegans

Alignment Length:428 Identity:103/429 (24%)
Similarity:176/429 (41%) Gaps:106/429 (25%)


  Fly     2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLGLLPWAIDKKADHKRYDHCLGAYKSAQ---D 63
            :|.|.|:|.:::...|.::::...||||:|:.|.||: :.:....:|.|:.|.||.:..|.   |
 Worm    45 IINDNVYGTVKVPRPIDKLIDTVEFQRLRHLKQTGLV-YLVYPNCEHSRFVHSLGTFSLAYALVD 108

  Fly    64 HLRAIERNSHYEPKL----PDWCRQAVEIAALLHDIGHGPMSHAW--ELVTHH--EFDHEENAMA 120
            .||      |.:|.|    .|..  ...:||||||:||||.||.:  |....:  .|.||:.::.
 Worm   109 KLR------HSQPSLNITESDLI--CTSVAALLHDVGHGPFSHLFDGEFAKRNGSRFKHEDMSIL 165

  Fly   121 CVDKIF-KDALNQELVSL---RDDGGGRGVQLIKALILGSS---------ENLP----------- 161
            .:.||. |..:..|...:   .|:...:.|.||..||.|..         ::||           
 Worm   166 IIKKIMNKPEIKSEFACILGETDEEYAKSVTLITELISGKPFDFQDMDGFKDLPADVREETVKNE 230

  Fly   162 FPMLG----HTYIFDIVHNRRCGLDVDKWDYLRRDNKRLKI-LSSAEMDFDDVFLQAR--ISPDG 219
            :.::|    .:::||:|.|...|.||||.|||.||:|...: ::.:|...:.:|...|  |.|:.
 Worm   231 WAIIGCGPEKSFLFDVVSNSYNGHDVDKMDYLLRDSKASGVGITFSESTLERLFNHVRVVIDPNS 295

  Fly   220 --QRIEYRYADYHRVYRLFEARSLLHVKAYQYPLTCAMDVI------------------------ 258
              :||.|.......:..:.::|..||.|.||:.....|:.:                        
 Worm   296 GLKRIAYSIKCIGDLKAIGDSRQELHSKVYQHKAVRFMETLMVDALINAGDFLKYKGSNGELYSL 360

  Fly   259 ---------FVSVVQRIAPELLSIRSKDPKWLELTDEYVLNVIEKD---PISRYVKEPHRLVEVP 311
                     |:.....:..|:|:.:..|||.:| ....:|.:..::   .:..:...|....::.
 Worm   361 KNVTEDVDAFLKTTDYVEQEILNSQITDPKMIE-AQTALLKIQRREIGCKLGYFEMNPENATQLK 424

  Fly   312 SNDCSGSDIIRVNRVIPGPWELIKSARELAFFGNKRKK 349
            .| |:..         .|..|::|..      |.|.|:
 Worm   425 GN-CNNQ---------TGAAEVVKKV------GQKMKE 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
falNP_001137974.1 HDc 48..210 CDD:238032 59/202 (29%)
ZK177.8NP_495054.1 HDc 90..284 CDD:238032 59/202 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C245435305
eggNOG 1 0.900 E1_COG1078
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H132165
Inparanoid 1 1.050 107 1.000 Inparanoid score I3460
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D426111at33208
OrthoFinder 1 1.000 FOG0002970
OrthoInspector 1 1.000 T476387
orthoMCL 1 0.900 OOG5_127247
Panther 1 1.100 LDO PTHR11373
Phylome 1 0.910 0.960 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2947
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.