| Sequence 1: | NP_001137974.1 | Gene: | fal / 43927 | FlyBaseID: | FBgn0028380 | Length: | 368 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031750064.1 | Gene: | LOC101730829 / 101730829 | -ID: | - | Length: | 508 | Species: | Xenopus tropicalis | 
| Alignment Length: | 436 | Identity: | 119/436 - (27%) | 
|---|---|---|---|
| Similarity: | 181/436 - (41%) | Gaps: | 101/436 - (23%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLGLLPWAIDKKADHKRYDHCLGAYKSAQDHLR 66 
  Fly    67 AIERNSHYEPKLPDWCRQAVEIAALLHDIGHGPMSHAWE------------------LVTHHE-- 111 
  Fly   112 ---FDH--EENAMACVDKIFKDALNQELVSLRDDGGGRGVQLIKALILGS--SENL---PFPMLG 166 
  Fly   167 H----TYIFDIVHNRRCGLDVDKWDYLRRDNKRLKILSSAEMDFDDVFLQARISPDGQR--IEYR 225 
  Fly   226 YADYHRVYRLFEARSLLHVKAYQYPLTCAMDVIF-----------------VSVVQRIAPELLSI 273 
  Fly   274 R---SKDPKWLELTDEYVLNVI-EKDPISRYVKE-----PHR-----LVEVPSNDCSGSDIIRVN 324 
  Fly   325 RVIPGPWELIKSARELAFFGNKRKKR--PITRCVSPTIVNKCFKLE 368 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| fal | NP_001137974.1 | HDc | 48..210 | CDD:238032 | 58/195 (30%) | 
| LOC101730829 | XP_031750064.1 | YdhJ | 14..>331 | CDD:224004 | 90/333 (27%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 79 | 1.000 | Inparanoid score | I5060 | 
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D426111at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0002596 | |
| OrthoInspector | 1 | 1.000 | - | - | otm48384 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X1701 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 5.060 | |||||