DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fal and LOC101730829

Sequence 1:NP_001137974.1 Gene:fal FlyBaseID:FBgn0028380 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_017953311.1 Gene:LOC101730829 ID: Length:453 Species:Xenopus tropicalis

Alignment Length:444 Identity:115/445 (26%)
Similarity:180/445 (40%) Gaps:109/445 (24%)


  Fly     2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLGLLPWAIDKKADHKRYDHCLGAYKSAQDHLR 66
            :..|.:||.|||...:..|::.|.||||:::.|||.: :.:...|.|.|::|.:|....|....|
 Frog    16 VFNDPIHGHIELHPLLVRIIDTPEFQRLRYIKQLGGI-YYVYPGASHNRFEHSIGVGHLAGCLAR 79

  Fly    67 AIERNSHYEPKLPDWCRQAVEIAALLHDIGHGPMSHAWE-------------------------L 106
            .: |:...|..:.|.....|:||.|.||:||||.||.:|                         :
 Frog    80 EL-RDRQPELNITDTDILCVQIAGLCHDLGHGPFSHLFESKFMSYKRDLQQQKLPTTAIKSGYNI 143

  Fly   107 VTHHEF----------DHEENAMACVDKI-----FKDALNQELVSLRDDGGGRGVQLIKALILGS 156
            :...|:          .||:.::...|.:     .|..|:.:.::..|      :..||.||:|.
 Frog   144 LPFGEYFGKQRDIGQDQHEDLSIKMFDHLIESNHLKAELSDQEITEPD------LTFIKELIMGC 202

  Fly   157 --SENL---PFPMLGH----TYIFDIVHNRRCGLDVDKWDYLRRDNKRLKILSSAEMDFDDVFLQ 212
              |:.|   |:|..|.    .:::.||.|:..|:||||:|||.||...|.|.:|  .|:......
 Frog   203 PLSDKLKLDPWPYEGRPVEKMFLYQIVANKENGIDVDKFDYLARDCYHLGIQNS--FDYKRFLKF 265

  Fly   213 ARISPDGQR--IEYRYADYHRVYRLFEARSLLHVKAYQYPLTCAMDVIF---------------- 259
            ||:...|.|  |..|..:...:|.:|..|..|:.:...:.:...::::.                
 Frog   266 ARVCDVGNRKHICVRDKEVWNLYNMFYTRYGLYRRTCHHRVVNVIEIMIGEAFGKADKYFKIKGS 330

  Fly   260 -VSVVQRIAPELLSIR---SKDPKWLELTDEYVLNVI-EKDPISRYVKE-----PHR-----LVE 309
             |.|...:..|||:|.   :....:.:|||...|.:: ..||.....||     .||     |.|
 Frog   331 KVKVDSEVKVELLTISGAVNDMVAYTKLTDAIFLQILYSSDPNLSAAKEILEKIVHRKFYSYLGE 395

  Fly   310 VPSNDCSGSDIIRVNRVIPGPWELIKSARELAFFGNKRKKR--PITRCVSPTIV 361
            ..||..|        :..|   :.||.:.|||    ...||  |..||.....|
 Frog   396 ATSNPTS--------KQTP---DKIKLSGELA----TAVKRGDPNLRCTEEDFV 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
falNP_001137974.1 HDc 48..210 CDD:238032 56/211 (27%)
LOC101730829XP_017953311.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D426111at33208
OrthoFinder 1 1.000 FOG0002970
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.