DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fal and samhd1

Sequence 1:NP_001137974.1 Gene:fal FlyBaseID:FBgn0028380 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_012808243.1 Gene:samhd1 XenbaseID:XB-GENE-976503 Length:630 Species:Xenopus tropicalis

Alignment Length:357 Identity:99/358 (28%)
Similarity:162/358 (45%) Gaps:65/358 (18%)


  Fly     2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLG----LLPWAIDKKADHKRYDHCLGAYKSAQ 62
            :..|.:||.|||...:..|::.|.||||:::.|||    :.|     .|.|.|::|.:|....|.
 Frog   114 VFNDPIHGHIELHPLLVRIIDTPEFQRLRYIKQLGGSYYVFP-----GASHNRFEHSIGVGYLAG 173

  Fly    63 DHLRAIERNSHYEPKLPDWCRQ--AVEIAALLHDIGHGPMSHAWE------LVTHHEFDHEENAM 119
            ..::|:...   :|:|....|.  .|:||.|.||:||||.||.::      .....:|.||..::
 Frog   174 CLVQALHER---QPELQINHRDMLCVQIAGLCHDLGHGPFSHMFDGRFMPLACPKRKFKHESASV 235

  Fly   120 ACVDKIFK-----DALNQELVSLRDDGGGRGVQLIKALILG-----------SSEN-LPFPMLGH 167
            |..|.:.|     :.:.:..:.|.||     :..||..|.|           ||:| ..:|..|.
 Frog   236 AMFDHLIKSNGLEEVMKEYGLCLPDD-----LTFIKEQIAGPLSSEDEQQFNSSQNSSSWPYRGR 295

  Fly   168 T----YIFDIVHNRRCGLDVDKWDYLRRDNKRLKILSSAEMDFDDVFLQARISPDGQR--IEYRY 226
            |    ::::||.|:|.|:|||||||..||...|.|.::  .|:......||:...|.:  |..|.
 Frog   296 TEEKSFLYEIVANKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFLKFARVCEVGSKKHICTRD 358

  Fly   227 ADYHRVYRLFEARSLLHVKAYQYPLTCAMDVIFVSVVQRIAPELLSIRSKDPK------------ 279
            .:...:|.:|..|:.||.:|||:.:...::.:......:..|. :.|:..|..            
 Frog   359 KEVGNLYDMFHTRNCLHRRAYQHKVGNIIETMITDAFIKADPH-IRIKGSDGNYYTISGSVDDMV 422

  Fly   280 -WLELTDEYVLNVIEKD-PISRYVKEPHRLVE 309
             :.:|||....:::..| |..:..:|..|.||
 Frog   423 AYTKLTDNIYHHILYSDNPDLKEAREILRKVE 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
falNP_001137974.1 HDc 48..210 CDD:238032 57/191 (30%)
samhd1XP_012808243.1 SAM_HD 40..107 CDD:188907
SAM 41..106 CDD:197735
HDc 159..340 CDD:238032 57/191 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C245452386
eggNOG 1 0.900 E1_COG1078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D426111at33208
OrthoFinder 1 1.000 FOG0002970
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.923 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.