DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fal and si:ch211-233g6.2

Sequence 1:NP_001137974.1 Gene:fal FlyBaseID:FBgn0028380 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_009294109.1 Gene:si:ch211-233g6.2 ZFINID:ZDB-GENE-121214-114 Length:538 Species:Danio rerio

Alignment Length:420 Identity:113/421 (27%)
Similarity:194/421 (46%) Gaps:82/421 (19%)


  Fly     2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLGLLPWAIDKKADHKRYDHCLGAYKSAQDHLR 66
            :..|.:||.|.|...:.:|.:.|.||||:|:.||| ..:.:...|.|.|::|.:|....|...::
Zfish    62 IFNDPIHGHIALHPLLVKITDTPQFQRLRHLKQLG-GTYLVYPGASHNRFEHSIGVAYLAGRLVK 125

  Fly    67 AIERNSHYEPKL----PDWCRQAVEIAALLHDIGHGPMSHAWELVTHHE---------------- 111
            ::..|   :|:|    .|:.  .|:||.|.||:||||:||.::::...|                
Zfish   126 SLHDN---QPELKITKQDFL--CVQIAGLCHDLGHGPLSHVFDVLVIPEVKKIKKLKGLPDDIPE 185

  Fly   112 -FDHEENAMACVDKIFKDALNQELVSLRDDG-GGRGVQLIKALILG--SSENLPFPMLGH----T 168
             :.||:.::...|.|.| :||:|:  ||:.| ....|..||.||.|  :|:| .:|..|.    :
Zfish   186 SWKHEQMSVLMFDSIVK-SLNEEV--LREHGLTDNDVIFIKELIEGAKASDN-EWPYQGRNVEKS 246

  Fly   169 YIFDIVHNRRCGLDVDKWDYLRRDNKRLKILSSAEMDFDDV----FLQARISPDGQRIEYRYADY 229
            ::::||.|::.|:|||||||..||...|.|.:|    ||.:    |.:..:....:.|.:|..:.
Zfish   247 FLYEIVANKQNGIDVDKWDYFARDCHHLGIRNS----FDHLRLLKFARVCVVNGRKHICFRDKEA 307

  Fly   230 HRVYRLFEARSLLHVKAYQYPLTCAMDVIFVSVV--------QRIAPELLSIRSKDPKWLE---- 282
            ..||.:|..|..||.:|||:.:...::.:|...:        ::...::|.| |:..|.:|    
Zfish   308 DNVYDMFRTRYTLHRQAYQHKIANIIEDMFAEALLLADRDLHEKKPADMLKI-SEAIKSVEDYSK 371

  Fly   283 LTDEY-----------------VLNVIEKDPISRYVKEPHRLVE-VPSNDCSGSDIIRVNRVIPG 329
            ||||.                 :|:.|.:..:.::::|....|: :...:...|....|....|.
Zfish   372 LTDEIFEQILSSTSPNLKESKDILDKIMRRKLPKFIREVRLTVKNMSKEELKNSWKAAVKTYKPT 436

  Fly   330 PWELIKSARELAFF-----GNKRKKRPITR 354
            ...:..:|.||..:     ...:.|.||.|
Zfish   437 DPTVTLTAEELPVYVVDLDHGMKDKNPIER 466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
falNP_001137974.1 HDc 48..210 CDD:238032 61/194 (31%)
si:ch211-233g6.2XP_009294109.1 YdhJ 59..504 CDD:224004 113/421 (27%)
HDc 107..286 CDD:238032 61/192 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C245460711
eggNOG 1 0.900 E1_COG1078
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H132165
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D426111at33208
OrthoFinder 1 1.000 FOG0002970
OrthoInspector 1 1.000 T597827
orthoMCL 1 0.900 OOG5_127247
Panther 1 1.100 O PTHR11373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.