DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rok and CDC42BPB

Sequence 1:NP_536796.2 Gene:Rok FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster
Sequence 2:XP_005268284.1 Gene:CDC42BPB HGNCID:1738 Length:1728 Species:Homo sapiens

Alignment Length:1364 Identity:382/1365 (28%)
Similarity:655/1365 (48%) Gaps:249/1365 (18%)


  Fly    21 RANTLEREMRD----PTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKYKPLAMQINQLR 81
            |...||:.:.|    ..|..:|:.|||.:..|.::|.|.:|||.|.:.::....||....:.:::
Human     6 RLKKLEQLLLDGPWRNESALSVETLLDVLVCLYTECSHSALRRDKYVAEFLEWAKPFTQLVKEMQ 70

  Fly    82 MNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWEERHIMAHANSEW 146
            ::.|||..||:||.||||||.:|:.|::.::||||.|:|:||:||.::|.|.|||.::.:.:.:|
Human    71 LHREDFEIIKVIGRGAFGEVAVVKMKNTERIYAMKILNKWEMLKRAETACFREERDVLVNGDCQW 135

  Fly   147 IVQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYD--IPEKWAIFYTMEVVLALDTIHNMGFVHRD 209
            |..||:||||..:||:|||:..|||:::|:..::  :||..|.||..|:|||:|:||.:.:||||
Human   136 ITALHYAFQDENHLYLVMDYYVGGDLLTLLSKFEDKLPEDMARFYIGEMVLAIDSIHQLHYVHRD 200

  Fly   210 VKPDNMLLDSYGHLKLADFGTCMRMGANGQVVSSNAVGTPDYISPEVLQS--QGVDNEYGRECDW 272
            :||||:|||..||::|||||:|::|..:|.|.||.|||||||||||:||:  .|: .:||.||||
Human   201 IKPDNVLLDVNGHIRLADFGSCLKMNDDGTVQSSVAVGTPDYISPEILQAMEDGM-GKYGPECDW 264

  Fly   273 WSVGIFLYEMLFGETPFYADSLVGTYGKIMDHKNSLSFPPEV-EISEQAKALIRAFLTDRTQRLG 336
            ||:|:.:||||:|||||||:|||.||||||:|:....||..| ::||:||.||:..:..|.:|||
Human   265 WSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERFQFPSHVTDVSEEAKDLIQRLICSRERRLG 329

  Fly   337 RYGIEDIKAHPFFRNDTWSFDNIRESVPPVVPELSSDDDTRNFEDIERDE-KPEEVFPVPK--GF 398
            :.||||.|.|.||....|  :|||....|.:|::||..||.|| |::.|. :..|:.|...  ||
Human   330 QNGIEDFKKHAFFEGLNW--ENIRNLEAPYIPDVSSPSDTSNF-DVDDDVLRNTEILPPGSHTGF 391

  Fly   399 DGNHLPFIGFTYTGD---------YQLLSSDTVDAESKEANVANSGAASNNHGHGHNHRHRPSNS 454
            .|.||||||||:|.:         ..::.|:|:   :|:.:|.                      
Human   392 SGLHLPFIGFTFTTESCFSDRGSLKSIMQSNTL---TKDEDVQ---------------------- 431

  Fly   455 NELKRLEALLERE--RGRSEALEQQDAGLRQQIELITKREAELQRIASEYEKDLALRQHNYKVAM 517
               :.||..|:.|  ..|...|||      :::||..|.:...|.:.|.:....||...|....:
Human   432 ---RDLEHSLQMEAYERRIRRLEQ------EKLELSRKLQESTQTVQSLHGSSRALSNSNRDKEI 487

  Fly   518 QKVEQEIELRKKTEALLVETQRNLENEQKTRARDLNINDKVVSLEKQLLEMEQSYKTETENTQKL 582
            :|:.:|||..|...|.....:|.||:....|....:...::..||||       ::...:..::|
Human   488 KKLNEEIERLKNKIADSNRLERQLEDTVALRQEREDSTQRLRGLEKQ-------HRVVRQEKEEL 545

  Fly   583 KKHNAELDFTVKSQEEKVRDMVDMIDTLQKHKEELGQENAELQALVVQEKNLRSQLKEMHKEAE- 646
            .|...|....:|||.::::|.........:...||.:..|||:|   |::.:..||::..:|.| 
Human   546 HKQLVEASERLKSQAKELKDAHQQRKLALQEFSELNERMAELRA---QKQKVSRQLRDKEEEMEV 607

  Fly   647 -------------------NKMQTLINDIERTMCREQKAQEDNRALLEKI-SDLEKAHAGLDFEL 691
                               .:::..::|......:|:|.:|.:....::: |:||        .|
Human   608 ATQKVDAMRQEMRRAEKLRKELEAQLDDAVAEASKERKLREHSENFCKQMESELE--------AL 664

  Fly   692 KAAQG--------RYQQEV-KAHQETEK------SRLVSREEANLQEVKALQSKLNEEKSARI-- 739
            |..||        .:|||: |...|.||      ..||.||.:::.|||.::.::::.:|.::  
Human   665 KVKQGGRGAGATLEHQQEISKIKSELEKKVLFYEEELVRREASHVLEVKNVKKEVHDSESHQLAL 729

  Fly   740 --------------KADQHSQEKERQLSMLSVDYRQIQLRLQKLEGECRQESEKVAALQSQLDQE 790
                          |.::|: |.|..:..:...|.:.:..|.....:...|:||:.:...:|..:
Human   730 QKEILMLKDKLEKSKRERHN-EMEEAVGTIKDKYERERAMLFDENKKLTAENEKLCSFVDKLTAQ 793

  Fly   791 HSKRNALLSELSLHSSEVAHLRSRENQLQKELSTQREAKRRFEEDLTQLKSTHHEALAN--NREL 853
            :.:....|.:|:.....|||..::..::.:.:|.:::|:            .:.:|||:  ..||
Human   794 NRQLEDELQDLAAKKESVAHWEAQIAEIIQWVSDEKDAR------------GYLQALASKMTEEL 846

  Fly   854 QAQLEAEQCFSRLYKTQANENREESAERLSKIEDLEEERVSLKHQVQVAVARADSEALARSIAEE 918
            :| |.:....||            :.:.|.|:...::..:|.:.::|.|:   ::|..|:.:.:|
Human   847 EA-LRSSSLGSR------------TLDPLWKVRRSQKLDMSARLELQSAL---EAEIRAKQLVQE 895

  Fly   919 TVADLEKEKTIKELELKDFVMKHRNEINAKEAALATLKEAENELHKKLGQKAAEYEDLVQQH--- 980
            .:..::......|.:|||...|:|..:...|   ...|:.|.:.....|.|..:::|.:.::   
Human   896 ELRKVKDANLTLESKLKDSEAKNRELLEEME---ILKKKMEEKFRADTGLKLPDFQDSIFEYFNT 957

  Fly   981 KKQQEELALMRSSKDEEITKLLDKCKNEVLLKQVAVNKLAEVMNRRDSDLPKQKNKARSTAELRK 1045
            .....:|....|......:.||            |..:.....:.:::..||.:.....:....:
Human   958 APLAHDLTFRDSLSSSSASSLL------------AFWEETSSASEQETQAPKPEASPSMSVAASE 1010

  Fly  1046 KEKEMRRLQQE-------------LSQERDKFNQLLLKHQDLQQLCAEEQQLKQKMVME------ 1091
            ::::|.|..|.             |:..:.|.:|..:|.......|:....|...::.:      
Human  1011 QQEDMARPPQRPSAVPLPTTQALALAGPKPKAHQFSIKSFSSPTQCSHCTSLMVGLIRQGYACEV 1075

  Fly  1092 ------IDCK--ATEIENLQSKLNETASLSSADNDPEDSQHSSLLSLTQ--DSVFEGWLSVPNKQ 1146
                  :.||  |.::               ....||.|:....:.:.:  .:.::|.:.||...
Human  1076 CSFACHVSCKDGAPQV---------------CPIPPEQSKRPLGVDVQRGIGTAYKGHVKVPKPT 1125

  Fly  1147 NRRRGHGWKRQYVIVSSRKIIFYNSDIDKHNTTD----AVLILDL-SKVYHVRSVTQGDVIRADA 1206
            ..::  ||:|.|.:|...|:..|  |:.:..:|.    |..:||| ...:.|.||...|||.|..
Human  1126 GVKK--GWQRAYAVVCDCKLFLY--DLPEGKSTQPGVIASQVLDLRDDEFSVSSVLASDVIHATR 1186

  Fly  1207 KEIPRIFQLLYAGEGASHRPDEQSQLDVSVLHGNCNEERP--------GTIVHKG---HEFVHI 1259
            ::||.||::..:..||   |.:.|.|  .:|..|.||:|.        .:|:||.   ::.||:
Human  1187 RDIPCIFRVTASLLGA---PSKTSSL--LILTENENEKRKWVGILEGLQSILHKNRLRNQVVHV 1245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747 178/358 (50%)
S_TKc 87..349 CDD:214567 145/267 (54%)
SbcC 484..1088 CDD:223496 128/674 (19%)
Rho_Binding 963..1027 CDD:286056 8/67 (12%)
PH_ROCK 1134..1250 CDD:269948 38/129 (29%)
C1 1254..1307 CDD:197519 2/7 (29%)
CDC42BPBXP_005268284.1 STKc_MRCK_beta 3..411 CDD:270774 194/409 (47%)
S_TKc 76..342 CDD:214567 145/267 (54%)
TPH 426..786 CDD:290579 85/410 (21%)
KELK 528..606 CDD:292424 21/88 (24%)
DMPK_coil 878..939 CDD:117396 14/67 (21%)
C1 1043..1092 CDD:237996 7/64 (11%)
PH_MRCK 1102..1236 CDD:269949 40/143 (28%)
CNH 1262..1527 CDD:279162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0612
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.