DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rok and tacc3

Sequence 1:NP_536796.2 Gene:Rok FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster
Sequence 2:XP_012814258.1 Gene:tacc3 XenbaseID:XB-GENE-483950 Length:900 Species:Xenopus tropicalis

Alignment Length:1058 Identity:197/1059 (19%)
Similarity:371/1059 (35%) Gaps:324/1059 (31%)


  Fly   117 RLSKFEMMKRPDSAFFWEERHIMAHANSEWIVQLHFAFQDA------KYLYMVMDFMPGGDIVSL 175
            |:....:..:|:|.|..:       |.::.:.|||.:...:      :.:..|.:..||.|    
 Frog    67 RIMTPSVANKPESGFSLD-------ACTQALEQLHLSVSTSCGTNPEEMITSVSNNQPGTD---- 120

  Fly   176 MGDYDIPEKWAIFYTMEVVLALDTIHNMGFVHRDVKPDNMLLDSYGHLKLADFGTCM-RMGANGQ 239
                |:|.:.|..|:::    .:.:.:|    ...|....:|:|  .:| ||..:.| ::..|..
 Frog   121 ----DLPVRTAGAYSID----FNNLDDM----NPFKSKTQMLNS--PIK-ADLPSPMEKIETNTP 170

  Fly   240 VVSSNAVGTPDYISPEVLQSQGVDNEYGRECDWWSVGIFLYEMLFGETPFYADSLVGTYGKIMDH 304
            |:    :...|.|..|.|.|...                                          
 Frog   171 VI----LADKDTIWSEALNSSAA------------------------------------------ 189

  Fly   305 KNSLSFPPEVEISEQAKAL---IRAFLTDRTQRLGRYGIEDIKAHPFFRNDTWSFDNIRESVPPV 366
              :|..|..|:.|.::..|   .:|.|.| |......|::|.:.     :|| |.:|..|   |:
 Frog   190 --NLDSPVTVQFSSESSTLGVSDKAALDD-TLPFSESGLKDARG-----SDT-SSNNAEE---PI 242

  Fly   367 VPELSSDDDTRNFEDIERDEKPEEVFP-VPKG---FDGNHLPFIGFTYTGDYQLLSSDTVDAESK 427
            :.|......|.:..:....:.|    | ||||   ||.:.:..|....||..:|           
 Frog   243 LLEKDIAAVTSSANNEANAQSP----PLVPKGSYSFDLDQIEMIDPFKTGGSKL----------- 292

  Fly   428 EANVANSGAASNNHGHGHNHRHRPSNSNELKRLEALLERERGRSEALEQ----QDAGLRQQIELI 488
                .||.|...        ::.|.::||.|.....||...|..:|..:    :..|.|...:..
 Frog   293 ----QNSPAGEK--------KNPPEDTNEAKAEPVKLEFNFGDGDAPARKPPPKKLGKRPPFKTA 345

  Fly   489 TKREAELQRIASEYEKDLALRQHNYKVAMQKVEQEIELRKKTEALLVETQRNLENEQKTRARDLN 553
            ||:.|..|.|.||..::...:....:.|....||..: ..:.:|::.:.....:.|   :..|.|
 Frog   346 TKKPAPKQEIVSETPEEQTAKPPEEQTAKPPEEQTAK-PPEEQAIVPKASYKFDWE---KFDDPN 406

  Fly   554 IN------DKVVSLEKQLLEMEQSYKTETENTQKLKKHNAELDFTVKSQEEKVRDMVDMIDTLQK 612
            .|      .|:.|..|       ..||.:|      :.:|.:..:....|....||....:  :.
 Frog   407 FNPFGCGGSKICSSPK-------GQKTASE------EQSAGIQDSTSKAECSETDMAPPEN--ED 456

  Fly   613 HKEELGQENAELQALVVQEKNLRSQLKEMHKEAENKMQTLINDIERTMCREQKAQEDNRALLEKI 677
            .|::||:......::..::|:          ||||....|.|                      :
 Frog   457 GKKDLGETEPAQDSVAPEDKS----------EAENTSVALSN----------------------V 489

  Fly   678 SDLEKAHAGLDFELKAAQGRYQQEVKAHQETEKSRLVSREEANLQE--VKALQSKLNEEKSARI- 739
            :..|.|     .:....|...|.||....:....:.:....:||.:  :.......|....|.. 
 Frog   490 TPHEPA-----ADCSPVQNETQPEVSTVSDEHFQKELDLTSSNLTDPIINGTDMAFNLPTDADFF 549

  Fly   740 -KADQHSQEKERQL-----SMLSVDYRQIQLRLQKLEGECRQESEKVAALQSQ--------LDQE 790
             .||...:......     ..:.:||.:          .....|.|.:||:.|        |.:|
 Frog   550 PAADMDFKPASEIFPGGFGQPIEIDYLE----------NFGSNSFKESALRKQSLYLKFDPLLRE 604

  Fly   791 HSKRNA----LLSELSLHSSEVAH----------LRSRENQLQKELSTQREAKRRFEEDLTQLKS 841
            ..|:||    |::.|.|.||.:..          ::|.||:         |..:..:.||....:
 Frog   605 SPKKNAAGNNLITSLPLKSSTLLFGTIPEANFPLIQSIENE---------EKPKGLDLDLLGTFT 660

  Fly   842 THHEA----------------LANN-----------RELQAQLEAEQCFSRLYKTQANENREESA 879
            ....|                |.|:           :::.|.:||       .:.:..|...|..
 Frog   661 VTDTAPLIVGAPCSGPVQDPFLLNSDAIVEVLKYSQKDMDAAIEA-------VRLEVQEKELEVL 718

  Fly   880 ERLSKIEDLEEERVSLKHQVQVAVARADSEALARSIAE------ETVADLEKEKTIKELELKDFV 938
            |..:|.|.|..|.|.                :.:.|||      :.:.|.:::|.:.:|||.. |
 Frog   719 EWKNKHEKLYLEYVE----------------MGKIIAEFEGTITQMLEDSQRQKEMGKLELSK-V 766

  Fly   939 MKHRNEINAKEAALATLKEAENELHKKLGQKAAEYEDLVQQHKKQQEELALMRSSKDEEITKLLD 1003
            ::.:.::   :..|.:::::.:|:.|:..::    :::::.::|.:|  ||.:..:|     .|.
 Frog   767 LQEKQQV---QVDLNSMEKSFSEMFKRFEKQ----KEVLEGYRKNEE--ALKKCVED-----YLA 817

  Fly  1004 KCKNEVLLKQVAVNKLAEVMNRRDSDLPKQKNKARS-----TAELRKKEKEMRRLQQEL---SQE 1060
            :.|.|....|.......|.:||.:.::...::||::     .|.|||::.:.:.|::.|   |:|
 Frog   818 RIKKEEQRYQALKAHAEEKLNRANEEIAHVRSKAKAEATALQATLRKEQMKTQSLERSLEQKSKE 882

  Fly  1061 RDKF----NQLLLKHQDL 1074
            .|:.    :.|:||.:.:
 Frog   883 NDELTKICDDLILKMEKI 900

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747 59/308 (19%)
S_TKc 87..349 CDD:214567 42/242 (17%)
SbcC 484..1088 CDD:223496 122/674 (18%)
Rho_Binding 963..1027 CDD:286056 13/64 (20%)
PH_ROCK 1134..1250 CDD:269948
C1 1254..1307 CDD:197519
tacc3XP_012814258.1 TACC 694..894 CDD:282818 47/238 (20%)
BAR 719..900 CDD:299863 44/212 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.