DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rok and rock1

Sequence 1:NP_536796.2 Gene:Rok FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster
Sequence 2:XP_002934180.2 Gene:rock1 XenbaseID:XB-GENE-984661 Length:1360 Species:Xenopus tropicalis

Alignment Length:1414 Identity:598/1415 (42%)
Similarity:857/1415 (61%) Gaps:133/1415 (9%)


  Fly    21 RANTLEREMRDPTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKYKPLAMQINQLRMNVE 85
            |...::..:|||.|..|.|||||.:.|:|.|.|..::|:.|||:.:..:||....::..|||..:
 Frog    10 RCGRIDGILRDPKSEVNTDCLLDGLDAMVYDLDFPAMRKNKNIDNFLNRYKDTMSKVRDLRMKAD 74

  Fly    86 DFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWEERHIMAHANSEWIVQL 150
            |:..:|:||.||||||||||||||.:|||||.|||.||:||.|||||||||.|||.|||.|:|||
 Frog    75 DYEVVKVIGRGAFGEVQLVRHKSSRKVYAMKLLSKLEMIKRSDSAFFWEERDIMAFANSPWVVQL 139

  Fly   151 HFAFQDAKYLYMVMDFMPGGDIVSLMGDYDIPEKWAIFYTMEVVLALDTIHNMGFVHRDVKPDNM 215
            .:||||.:||||||::|||||:|:||.:||:|||||.|||.|||||||.||:|||:|||||||||
 Frog   140 FYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNM 204

  Fly   216 LLDSYGHLKLADFGTCMRMGANGQVVSSNAVGTPDYISPEVLQSQGVDNEYGRECDWWSVGIFLY 280
            |||..||||||||||||:|...|.|....|||||||||||||:|||.|..|||||||||||:|||
 Frog   205 LLDKSGHLKLADFGTCMKMNREGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLY 269

  Fly   281 EMLFGETPFYADSLVGTYGKIMDHKNSLSFPPEVEISEQAKALIRAFLTDRTQRLGRYGIEDIKA 345
            |||.|:||||||||||||.|||:|||||:||.:.:||::||.||.||||||..||||.|:|:||.
 Frog   270 EMLVGDTPFYADSLVGTYSKIMNHKNSLTFPEDSDISKEAKNLICAFLTDREVRLGRNGVEEIKR 334

  Fly   346 HPFFRNDTWSFDNIRESVPPVVPELSSDDDTRNFEDIERDEKPEEVFPVPKGFDGNHLPFIGFTY 410
            ||||:||.|:::.:|::|.||||:|:||.||.||:|:|.|:..||.||:||.|.||.|||:||||
 Frog   335 HPFFKNDQWAWETLRDTVAPVVPDLTSDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTY 399

  Fly   411 TGDYQLL-----------SSDTVD---AESKEANVANSGAASNNHGHGHNHRHRPSNSNELKRLE 461
            ..:.|.|           ||.|||   .|:.:.|:                          .:||
 Frog   400 YSNRQYLDDPSANPNDNRSSSTVDKNLVENLQKNI--------------------------YQLE 438

  Fly   462 ALLERERGRSEALEQQDAGLRQQIELITK-------REAELQRIASEYEKDLALRQHNYKVAMQK 519
            ..|..|....:.:||:......:::.|.|       :...|:.:.::.||:..:.||......:|
 Frog   439 EQLHNEMQLKDEMEQKCRMSNIKLDKIMKELDEEGNQRKNLESLVAQTEKEKMMLQHRINEYQRK 503

  Fly   520 VEQEIELRKKTEALLVETQRNLENEQKTRARDLNINDKVVSLEKQLLEMEQSYKTETENTQKLKK 584
            .|||.|.|:..|..:...:..||:.:|........|:|:..|:|||.|.....:||::...:|:|
 Frog   504 AEQESEKRRNVENEVSTLKDQLEDFKKISQTSHITNEKIAQLQKQLEEANDLLRTESDTAVRLRK 568

  Fly   585 HNAELDFTVKSQEEKVRDMVDMIDTLQKHKEELGQENAELQALVVQEKNLRSQLKEMHKEAENKM 649
            ...|:..||...|...|::.|....|:..|.::.::...|||.:..|:..|||..||..:.:.:|
 Frog   569 SQTEMSKTVSQLEALNRELQDRCRLLESSKSQVEKDYFHLQAALDSERRDRSQGSEMIGDLQARM 633

  Fly   650 QTLINDIERTMCREQKAQEDNRALLEKISDLEK----AHAGLDFELKAAQGRYQQEVKAHQETEK 710
            .:|..:::......:.|:.:.:...:.:::.||    ....|:::||..|...:||:..|:.| |
 Frog   634 ASLQEELKHVKNNLEMAESERKRAQDLLNNSEKEKNNLEIDLNYQLKTLQQMLEQEINEHKVT-K 697

  Fly   711 SRLVSREEANLQEVKA-----LQSKLNEEKSARIKADQHSQEKERQLSMLSVDYRQIQLRLQKLE 770
            :||..|.: :.:|.|:     ::.|:..|::|:.||:....|.|:|.|||..|.:|.:.:::...
 Frog   698 ARLSDRHQ-SFEEEKSVAMCEMEMKVKGERAAKEKAENRRVEIEKQCSMLEFDLKQSRQKMEHFT 761

  Fly   771 GECRQESEKVAALQSQLDQEHSKRNALLSELSLHSSEVAHLRSRENQLQKELSTQREAKRRFEED 835
            .:..:..|:|..|..||:.|..||....:||:.|:..|..|:..|.||::|::|..||||..|.:
 Frog   762 QQRERLEEEVKQLTLQLEHETKKRIVTQNELNQHAGLVDTLKGSEKQLKQEINTLLEAKRLLEFE 826

  Fly   836 LTQLKSTHHEALANNRELQAQLEAEQCFSRLYKTQANENREESAERL-------SKIEDLEEERV 893
            |.||...:.......||||.||||||.||.|||||..|.:||..|:.       .::.:|..::.
 Frog   827 LGQLTKQYRGNEGQMRELQDQLEAEQYFSTLYKTQVRELKEEVEEKTKHSHELEKRVHELYNDKD 891

  Fly   894 SLKHQVQVAVARADSEALARSIAEETVADL----------------EKEKTIKELELKDFVMKHR 942
            :|..|:.:|..:|:||.|||::.||...::                ||:.||::||       ..
 Frog   892 TLTAQLDLAETKAESEQLARTLLEEQYFEVNQENKKLSARSWQDNTEKDHTIRKLE-------ET 949

  Fly   943 NEINAKEAALATLKEAENELHKKLGQKAAEYEDLVQQHKKQQEELALMRSSKDEEITKLLDKCKN 1007
            |....|:  :.||.:|..|    |.:||.:.|   |::|:::||:..:|:|.::.|       ..
 Frog   950 NSTLTKD--VQTLTKANEE----LSEKARKLE---QEYKEKEEEIYNLRNSYEKAI-------NT 998

  Fly  1008 EVLLKQVAVNKLAEVMNRRDSDLPKQKNKARSTAELRKKEKEMRRLQQELSQERDKFNQLLLKHQ 1072
            |..||..|||||||:|||:|..|.::|   .:|.:|||||||.|:||.:|:||::|:||::.|:|
 Frog   999 EKTLKTQAVNKLAEIMNRKDFKLDRKK---ANTQDLRKKEKENRKLQLDLNQEKEKYNQMVAKYQ 1060

  Fly  1073 -----DLQQLCAEEQQLKQKMVMEIDCKATEIENLQSKLNETA----SLSSADNDPEDSQHSSLL 1128
                 .|.|| .||...|.::.|::|.|.::||.|:::|.:..    |.|.|...|:|:.     
 Frog  1061 KELDETLMQL-TEESNYKNELQMQLDSKESDIEQLRARLADLQLRMDSTSVASLQPDDTD----- 1119

  Fly  1129 SLTQDSVFEGWLSVPNKQNRRRGHGWKRQYVIVSSRKIIFYNSDIDKHNTTDAVLILDLSKVYHV 1193
            .:..:|..|||||:||:.|.:| :|||:|||:|||:||:|||.:.:|..::.: ::||:.|::||
 Frog  1120 GIIGESRIEGWLSIPNRGNIKR-YGWKKQYVVVSSKKILFYNDEQNKEQSSPS-MVLDIDKLFHV 1182

  Fly  1194 RSVTQGDVIRADAKEIPRIFQLLYAGEGASHRPDEQSQLDVSVLHGNCNEERPGTIVHKGHEFVH 1258
            |:||||||.||:.:|||||||:|||.||...:..|...:.        ..|:...:.||||||:.
 Frog  1183 RAVTQGDVYRANTEEIPRIFQILYANEGECRKDVELEPVQ--------QTEKTNFLNHKGHEFIP 1239

  Fly  1259 ITYHMPTACEVCPKPLWHMFKPPAAYECKRCRNKIHKEHVDKHDPL-APCKLNHDPRSARDMLLL 1322
            ..||.|..||.|.|||||:||||.|.||:||..|.||:|:||.:.| :|||:::|..||||||||
 Frog  1240 TLYHFPANCEACAKPLWHVFKPPPALECRRCHVKCHKDHLDKKEELISPCKVSYDVTSARDMLLL 1304

  Fly  1323 AATPEDQSLWVARLLKRIQKSGYKAASYNNNSTDGSKISPSQSTRSSYK 1371
            |.|.|:|:.||:.|:|:|.|:........|..|..::.|.:||.|...|
 Frog  1305 ACTQEEQTKWVSHLVKKIPKTPPPTLVRGNQRTMSTRSSTNQSFRKPAK 1353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747 240/350 (69%)
S_TKc 87..349 CDD:214567 195/262 (74%)
SbcC 484..1088 CDD:223496 200/648 (31%)
Rho_Binding 963..1027 CDD:286056 24/64 (38%)
PH_ROCK 1134..1250 CDD:269948 53/116 (46%)
C1 1254..1307 CDD:197519 31/54 (57%)
rock1XP_002934180.2 STKc_ROCK1 2..406 CDD:270772 257/396 (65%)
S_TKc 76..338 CDD:214567 195/262 (74%)
Smc <424..1107 CDD:224117 215/738 (29%)
HR1_ROCK1 491..556 CDD:212029 19/65 (29%)
Rho_Binding 954..1018 CDD:286056 29/80 (36%)
PH_ROCK 1125..1231 CDD:269948 53/116 (46%)
C1 1235..1289 CDD:237996 31/54 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79000418
eggNOG 1 0.900 E2759_KOG0612
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D36370at33208
OrthoFinder 1 1.000 FOG0002297
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.