DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: syd and Spag9

Sequence 1:NP_524652.1 Gene:syd FlyBaseID:FBgn0024187 Length:1227 Species:Drosophila melanogaster
Sequence 2:XP_017452873.1 Gene:Spag9 RGDID:1311289 Length:1343 Species:Rattus norvegicus

Alignment Length:1423 Identity:588/1424 (41%)
Similarity:793/1424 (56%) Gaps:285/1424 (20%)


  Fly     2 MDNDDALLNNGGP-QSGAETVYGTEDNNMVMSEKNEQVVSIVQQLAGSIYQEFERMINRYDEDVV 65
            |:.:|.::....| .|||           ||||:       |..||||||:||||:|.||||:||
  Rat     1 MELEDGVVYQEEPGGSGA-----------VMSER-------VSGLAGSIYREFERLIGRYDEEVV 47

  Fly    66 KNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQ 130
            |.||||:|.|||.||:.:..:||..||:||||:|||||:|||||||:.||.:|:|.:|.||..||
  Rat    48 KELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQ 112

  Fly   131 ENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERT 195
            |.|:|.||:||:||..|.||||.||..:..||||||||:||||||.||:|:||:..|:::::|||
  Rat   113 EKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERT 177

  Fly   196 KM--LMGSTHSQMSTASERMDVSRARLNPVARSSGPVSYGFASLENSVMLDTETICSVGSQSDDS 258
            |:  |.||...: :||..|:...|    |::....|:..|...|........||..|...:..:.
  Rat   178 KLHQLSGSEQLE-ATAHSRIRKER----PISLGIFPLPAGDGLLTPDTQKGGETPGSEQWKFQEL 237

  Fly   259 GPPSLQNEL------DNLSGTLERGAATDALQQQHHATSPQS---PDSSPVVPNVPT-------- 306
            ..|.....|      :.|....:....:|..|....||:|.|   .|.|.:.|:.|:        
  Rat   238 SQPRSHTSLKVSHSPEPLKAVEQEDELSDISQGGSKATTPASTANSDVSAIPPDTPSKEDNEGLV 302

  Fly   307 ------------------------NVGRSTTKKEQRS--------------DNNL---------- 323
                                    ||...:.:.|::|              |.:|          
  Rat   303 KGTDTPNKAEISKHIEVQVAQETRNVSTDSAENEEKSEVQAIIESTPELDMDKDLSGYKGSSTPT 367

  Fly   324 --YQELSFQDNEESEENEIVT-GSWVHP---------GEYASSANDNYFGMGKEVENLIMENNEL 376
              .:..:|..|.||...|:.: ||.:..         |||   ::.::||||:||||||:||.:|
  Rat   368 KGIENKAFDRNTESLFEELSSAGSGLIGDVDEGADLLGEY---SDHSFFGMGREVENLILENTQL 429

  Fly   377 LATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAK---EQVKQ 438
            |.||||||:||:|||.||||||.|.::::.||.|::|::.||.::..|||:||:||:   |..:|
  Rat   430 LETKNALNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQ 494

  Fly   439 QNTEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAVRLTEILRASRTVDNLDRKSKQ 503
            :..:.:::|:|.||||||||||||.||||||||||||||||||||.||::||||....:..|.:.
  Rat   495 KAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAMQEKKRS 559

  Fly   504 SIWKYFSNLFTPS---------------NRPTERVADGLGGGPMFRHTGGGSPAHSHGSPS---R 550
            |||::||.||:.|               |.||                       ||.:||   |
  Rat   560 SIWQFFSRLFSSSSNAAKKPEPPVNLKYNAPT-----------------------SHVTPSVKKR 601

  Fly   551 GSGGGDNRLALTSGQPPVHPASAGLANALIMPKDYAEEGSSERISARR---REQYRQLRAHVQKE 612
            .|         |..|.|...:.|         .|:..|.:...:::||   ||||||::||||||
  Rat   602 SS---------TLSQLPGDKSKA---------FDFLSEETEASLASRREQKREQYRQVKAHVQKE 648

  Fly   613 DGRLHAYGWSLPINKASQEANPNRHS--GGVPVPVYCNPLAEASPHMKVFCAAGVNLHGGFTKNG 675
            |||:.|:||||| .|..|.||....:  ..:|||||..||.|....||::||.||||.||.|::|
  Rat   649 DGRVQAFGWSLP-QKYKQVANGQGENKMKNLPVPVYLRPLDEKDASMKLWCAVGVNLSGGKTRDG 712

  Fly   676 QSLIPANSPYAPKSTLKIAEITSPTADQ-SMEALDRQMARVSLETLEPETQLSSFVWICTSTHAA 739
            .|::.|:..|...|.|:.......:|.| |::.||:::.....| |:.:.:|||.||||||||:.
  Rat   713 GSVVGASVFYKDVSALESEGSKQRSASQSSLDKLDQELKEQQKE-LKNQEELSSQVWICTSTHST 776

  Fly   740 STVSVVDANQSATVLDAFPICASHLLCIASVQGAMESDY----ALLEQSEVVKA---GEMLQR-P 796
            :.|.::||.|...:||:|.:|.||:||||||.||.|:||    .|.:..:|.:|   |.|... .
  Rat   777 TKVIIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDYPAGEELSDSGQVDRASLCGSMTSNSS 841

  Fly   797 GEGTELLGKVEFVRV----------------------KPKSDDEQNSN-EKQQQEEEEAKEATEK 838
            .|...|||.:..|..                      ||...:.:||. ::.....|||.||||.
  Rat   842 AEMDSLLGGITVVGCSTEGVTGAAASPSTNGASPVIEKPPEVEAENSEIDENIPTAEEATEATEG 906

  Fly   839 SNEQLPAVSAEEPLGNVEAIKIRQPLPGA-PQRLSTD--GNQTNNNNN----SSSSSNLLFATKS 896
            :     |.|.|      :|:.|.|  ||. .:.:.||  |.|...:.:    ||:.|::.....|
  Rat   907 N-----AGSTE------DAVDISQ--PGVYTEHVFTDPLGVQIPEDLSPVFQSSNDSDVYKDQIS 958

  Fly   897 LNPILETKDRDE-PAMSSVGPTMWLGAQDGWLYVHSSVGRWHECLHRVLLPDAVLAIVHVEARVV 960
            :.|..:...|:| ..|||:.||||||||:|.|||||||.:|.:|||.:.|.|::|:||||:..|:
  Rat   959 VLPNEQDLAREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVL 1023

  Fly   961 VALANAQLAVFRRQTDGQWDLNSYHLVTLGDRNHSIRCLCVAGERIWAAHRNKIFIVDPVSLNIV 1025
            ||||:..||:|.|..||||||::|||:.||..:|||||:.|..:::|..:||||::|.|.::.|.
  Rat  1024 VALADGTLAIFHRGLDGQWDLSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIE 1088

  Fly  1026 HSLDAHPRKESQVRQMAATGAGVWVSIRLDSTLRLYNTHTFEHKQDVDIEPYVSKMLGTGKLGFS 1090
            .|.||||||||||||:|..|.|||||||||||||||:.||::|.|||||||||||||||||||||
  Rat  1089 KSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFS 1153

  Fly  1091 FVRITALMVSCNRLWIGTSNGVIISVPLAEV------------QPKSSSDPHGQ----------- 1132
            |||||||||||||||:||.||||||:||.|.            ..|:|..|..:           
  Rat  1154 FVRITALMVSCNRLWVGTGNGVIISIPLTETVILHQGRLLGLRANKTSGTPGNRPGSVIRVYGDE 1218

  Fly  1133 ----------MPLCCMANAQLSFHGHRDAVKFFVSVP--MLQQPNLNGGLTFT------------ 1173
                      :|.|.||:|||.||||||||||||:||  ::...:.:.|...|            
  Rat  1219 NSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVVSPQSSSSGADLTADKAGSSAQEPS 1283

  Fly  1174 NKRP--DMLVMCGGEGYIDFRINDNDMEN-----SIQLEPNQTIENRGDKSYLIVWHV 1224
            ::.|  .|||:.|||||||||:.|...|:     .:.|||:.|   :.::|:||||.|
  Rat  1284 SQTPLKSMLVISGGEGYIDFRMGDEGGESELLGEDLPLEPSVT---KAERSHLIVWQV 1338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sydNP_524652.1 Jnk-SapK_ap_N 43..196 CDD:286787 96/153 (63%)
JIP_LZII 362..430 CDD:293080 41/68 (60%)
Vps53_N 374..>524 CDD:282020 87/168 (52%)
Spag9XP_017452873.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40867398
eggNOG 1 0.900 E1_KOG2077
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2954
Inparanoid 1 1.050 869 1.000 Inparanoid score I386
OMA 1 1.010
OrthoDB 1 1.010 D165438at33208
OrthoFinder 1 1.000 FOG0001634
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13886
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
98.960

Return to query results.
Submit another query.