DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ret and Drl-2

Sequence 1:NP_477044.1 Gene:Ret FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_001286371.1 Gene:Drl-2 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster

Alignment Length:284 Identity:86/285 (30%)
Similarity:141/285 (49%) Gaps:17/285 (6%)


  Fly   771 LQLDTVLGEGEFGQVLKGFATEIAGLPGITTVAVKMLKKGSNSVEYMALLSEFQLLQEVSHPNVI 835
            |..:.::.||.||::..|...|..      ...||.:..|::..:...||.:..||..|||.:::
  Fly   381 LSYEELVKEGTFGRIYAGKLGESC------EALVKTVIDGASLTQVACLLQDASLLIGVSHQHIL 439

  Fly   836 KLLGACTSSEA-PLLIIEYARYGSLRSYLRLSRKIECAGVDFADGVEPVNVKMVLTFAWQICKGM 899
            ..|.|.|.... |.:...:...|:|:.||:.||:...|          ::.:.::.|...|.||:
  Fly   440 APLLANTELPGPPEIAYPHPSKGNLKMYLQKSRESSTA----------LSTRQLVEFGLHITKGL 494

  Fly   900 AYLSELKLVHRDLAARNVLLADGKICKISDFGLTRDVYEDDAYLKRSRDRVPVKWMAPESLADHV 964
            |||..|.:||:|:|.||..|.:....||.|..|:||::.||.......:..|:||::.|||...|
  Fly   495 AYLHSLGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKWLSLESLQKRV 559

  Fly   965 YTSKSDVWSFGVLCWELITLGASPYPGIAPQNLWSLLKTGYRMDRPENCSEAVYSIVRTCWADEP 1029
            |.::.|||:.||..|||:||...|:..:....|.:.|..|:|:::|.||.:..::::..||..|.
  Fly   560 YATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAGFRLEQPVNCPDEFFTVMNCCWHCEA 624

  Fly  1030 NGRPSFKFLASEFEKLLGNNAKYI 1053
            ..||:...|.|..:....:...||
  Fly   625 KQRPTPSQLLSYLQDFHADLGMYI 648

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RetNP_477044.1 PKc_like 770..1049 CDD:304357 84/279 (30%)
TyrKc 771..1042 CDD:197581 84/272 (31%)
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 84/279 (30%)
STYKc 389..637 CDD:214568 83/264 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24416
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.