DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ret and FGFR1

DIOPT Version :10

Sequence 1:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_001167538.1 Gene:FGFR1 / 2260 HGNCID:3688 Length:853 Species:Homo sapiens


Alignment Length:442 Identity:164/442 - (37%)
Similarity:239/442 - (54%) Gaps:66/442 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   699 VITCPLLFVLLLLC---LLIA--------------------QRKMLQRRLGK----QSMTTSSKQ 736
            |:|.||...:::.|   .||:                    ..:|...:|.|    :...|.|..
Human   399 VMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSAD 463

  Fly   737 ALPESGGGDFALMPLQ---SGFRFESG--------DAKWEFPREKLQLDTVLGEGEFGQVLKGFA 790
            :......|...:.|.:   ||....:|        |.:||.||::|.|...||||.||||:   .
Human   464 SSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVV---L 525

  Fly   791 TEIAGL----PG-ITTVAVKMLKKGSNSVEYMALLSEFQLLQEV-SHPNVIKLLGACTSSEAPLL 849
            .|..||    |. :|.|||||||..:...:...|:||.::::.: .|.|:|.||||||......:
Human   526 AEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYV 590

  Fly   850 IIEYARYGSLRSYLRLSRKIECAGVDFA-----DGVEPVNVKMVLTFAWQICKGMAYLSELKLVH 909
            |:|||..|:||.||:..|.   .|:::.     :..|.::.|.:::.|:|:.:||.||:..|.:|
Human   591 IVEYASKGNLREYLQARRP---PGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIH 652

  Fly   910 RDLAARNVLLADGKICKISDFGLTRDVYEDDAYLKRSRDRVPVKWMAPESLADHVYTSKSDVWSF 974
            |||||||||:.:..:.||:||||.||::..|.|.|.:..|:||||||||:|.|.:||.:||||||
Human   653 RDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSF 717

  Fly   975 GVLCWELITLGASPYPGIAPQNLWSLLKTGYRMDRPENCSEAVYSIVRTCWADEPNGRPSFKFLA 1039
            |||.||:.|||.|||||:..:.|:.|||.|:|||:|.||:..:|.::|.||...|:.||:||.|.
Human   718 GVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLV 782

  Fly  1040 SEFEKL--LGNNAKYIDLETNAVSNPL--YCGD--DSALITTELGEPESLQH 1085
            .:.:::  |.:|.:|:||     |.||  |...  |:...|...||.....|
Human   783 EDLDRIVALTSNQEYLDL-----SMPLDQYSPSFPDTRSSTCSSGEDSVFSH 829

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RetNP_477044.1 Protein Kinases, catalytic domain 770..1049 CDD:473864 129/291 (44%)
FGFR1NP_001167538.1 IgI_1_FGFR 58..151 CDD:409362
Ig strand A 58..61 CDD:409362
Ig strand A' 73..79 CDD:409362
Ig strand B 82..92 CDD:409362
Ig strand C 96..101 CDD:409362
Ig strand C' 104..106 CDD:409362
Ig strand D 111..115 CDD:409362
Ig strand E 118..123 CDD:409362
Ig strand F 129..138 CDD:409362
Ig strand G 141..151 CDD:409362
IgI_2_FGFR 184..278 CDD:409443
Ig strand A 184..187 CDD:409443
Ig strand A' 195..200 CDD:409443
Ig strand B 204..212 CDD:409443
Ig strand C 218..223 CDD:409443
Ig strand C' 226..228 CDD:409443
Ig strand D 237..240 CDD:409443
Ig strand E 244..249 CDD:409443
Ig strand F 258..265 CDD:409443
Ig strand G 268..278 CDD:409443
Ig 286..390 CDD:472250
Ig strand B 304..308 CDD:409353
Ig strand C 317..321 CDD:409353
Ig strand E 355..359 CDD:409353
Ig strand F 369..374 CDD:409353
Ig strand G 382..385 CDD:409353
PTKc_FGFR1 495..796 CDD:270678 135/306 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.