DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ret and Y43C5B.2

DIOPT Version :10

Sequence 1:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_501907.1 Gene:Y43C5B.2 / 189849 WormBaseID:WBGene00012785 Length:245 Species:Caenorhabditis elegans


Alignment Length:144 Identity:36/144 - (25%)
Similarity:62/144 - (43%) Gaps:27/144 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   764 WEFPREKLQLDTVLGEGEFGQVLKGFATEIAGLPGITTVAVKMLKKGSNSVEYM-ALLSEFQLLQ 827
            ||...:.::....||||.||:|:.|......|...: .||:|..|..:.:.|.: ..:.|.::::
 Worm   119 WELDHDNIEPLKKLGEGAFGEVMMGTMKFRKGGKSV-QVAIKQAKLSNLTKEQIKEFMGEARVMR 182

  Fly   828 EVSHPNVIKLLGACTSSEAPLLIIEYARYGSLRSYL-RLSRKIECAGVDFADGVEPVNVKMVLTF 891
            .:|||:|::..|      .|...:..|...||..:| :..||:.||...|               
 Worm   183 SLSHPHVVRFYG------VPRRRVNVALCRSLNEFLAKCHRKLRCATPFF--------------- 226

  Fly   892 AWQICKGMAYLSEL 905
               :|..:.:||.|
 Worm   227 ---VCMSVNWLSVL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RetNP_477044.1 Protein Kinases, catalytic domain 770..1049 CDD:473864 34/138 (25%)
Y43C5B.2NP_501907.1 SH2_Fps_family 11..104 CDD:198224
Protein Kinases, catalytic domain 129..>218 CDD:473864 25/95 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.