DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ras and IMD2

Sequence 1:NP_001356940.1 Gene:ras FlyBaseID:FBgn0003204 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_012088.3 Gene:IMD2 SGDID:S000001259 Length:523 Species:Saccharomyces cerevisiae

Alignment Length:515 Identity:306/516 (59%)
Similarity:387/516 (75%) Gaps:6/516 (1%)


  Fly    27 KSTTGFDAEL--QDGLSCKELFQN--GEGLTYNDFLILPGYIDFTAEEVDLSSPLTKSLTLRAPL 87
            |:...|...|  .||||.:||..:  ..||||||||||||.:||.:.||.|.:.||:::||..||
Yeast     8 KTALDFTKSLPRPDGLSVQELMDSKIRGGLTYNDFLILPGLVDFASSEVSLQTKLTRNITLNIPL 72

  Fly    88 VSSPMDTVTESEMAIAMALCGGIGIIHHNCTPEYQALEVHKVKKYKHGFMRDPSVMSPTNTVGDV 152
            ||||||||||||||..|||.||||.||||||||.||..|.:||.|::||:.:|.|:|||.|||:.
Yeast    73 VSSPMDTVTESEMATFMALLGGIGFIHHNCTPEDQADMVRRVKNYENGFINNPIVISPTTTVGEA 137

  Fly   153 LEARRKNGFTGYPVTENGKLGGKLLGMVTSRDIDFRENQPEVLLADIMTTELVTAPNGINLPTAN 217
            ...:.|.||.|:|||.:||...||:|::|||||.|.|:. .:|:.|:||...||...||.|...|
Yeast   138 KSMKEKYGFAGFPVTTDGKRNAKLVGVITSRDIQFVEDN-SLLVQDVMTKNPVTGAQGITLSEGN 201

  Fly   218 AILEKSKKGKLPIVNQAGELVAMIARTDLKKARSYPNASKDSN-KQLLVGAAIGTRSEDKARLAL 281
            .||:|.|||:|.:|::.|.||:|::||||.|.::||.|||.:| ||||.||:|||...||.||.|
Yeast   202 EILKKIKKGRLLVVDEKGNLVSMLSRTDLMKNQNYPLASKSANTKQLLCGASIGTMDADKERLRL 266

  Fly   282 LVANGVDVIILDSSQGNSVYQVEMIKYIKETYPELQVIGGNVVTRAQAKNLIDAGVDGLRVGMGS 346
            ||..|:||:|||||||||::::.|:|::||::|.|:||.||||||.||.|||.||.||||:|||:
Yeast   267 LVKAGLDVVILDSSQGNSIFELNMLKWVKESFPGLEVIAGNVVTREQAANLIAAGADGLRIGMGT 331

  Fly   347 GSICITQEVMACGCPQATAVYQVSTYARQFGVPVIADGGIQSIGHIVKAIALGASAVMMGSLLAG 411
            |||||||||||||.||.||||.|..:|.|||||.:||||:|:||||.||:|||:|.||||.:|||
Yeast   332 GSICITQEVMACGRPQGTAVYNVCEFANQFGVPCMADGGVQNIGHITKALALGSSTVMMGGMLAG 396

  Fly   412 TSEAPGEYFFSDGVRLKKYRGMGSLEAMERGDAKGAAMSRYYHNEMDKMKVAQGVSGSIVDKGSV 476
            |:|:|||||:.||.|||.||||||::||::...||.|.:..|.:|.|.:.|||||||::|||||:
Yeast   397 TTESPGEYFYQDGKRLKAYRGMGSIDAMQKTGTKGNASTSRYFSESDSVLVAQGVSGAVVDKGSI 461

  Fly   477 LRYLPYLECGLQHSCQDIGANSINKLRDMIYNGQLRFMKRTHSAQLEGNVHGLFSYEKRL 536
            .:::|||..||||||||||..|:..|::.:..|::||..||.||||||.||.|.||||||
Yeast   462 KKFIPYLYNGLQHSCQDIGCRSLTLLKNNVQRGKVRFEFRTASAQLEGGVHNLHSYEKRL 521

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rasNP_001356940.1 None
IMD2NP_012088.3 PTZ00314 21..518 CDD:240355 299/498 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0516
Hieranoid 1 1.000
Homologene 1 1.000 H68096
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001113
OrthoInspector 1 1.000 T634615
orthoMCL 1 0.900 OOG5_126887
Panther 1 1.100 O PTHR11911
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.780

Return to query results.
Submit another query.