DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: amx and Tm2d3

Sequence 1:NP_001245591.1 Gene:amx FlyBaseID:FBgn0000077 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_835157.1 Gene:Tm2d3 MGIID:1915884 Length:261 Species:Mus musculus

Alignment Length:185 Identity:93/186 (50%)
Similarity:119/186 (64%) Gaps:11/186 (6%)


  Fly   111 PYDKETP----CDRLQFPCIRCNYNHGCIYGRDLNVTCEVINNVQCLG-----ERSFQRQMNCRY 166
            ||..:.|    |.||...||.|..|..|.||:.:...|.|..:|.|:.     :|:|...|.||:
Mouse    77 PYMTKCPSNGLCSRLPADCIECATNVSCTYGKPVTFDCTVKPSVTCVDQDLKPQRNFVINMTCRF 141

  Fly   167 CYQTEMWQQSCGQRSSCNSAT--DKLFRTNCTVHHDVLCLGNRSFTRNLRCNWTQGYRWSTALLI 229
            |:|.......|...::|.:..  .:.:..||||...:.|||||:|.:.|.||||.||:|||||.:
Mouse   142 CWQLPETDYECSNSTTCMTVACPRQRYFANCTVRDHIHCLGNRTFPKLLYCNWTGGYKWSTALAL 206

  Fly   230 SLTLGGFGADRFYLGHWQEGIGKLFSFGGLGVWTIIDVLLISMHYLGPADGSLYI 284
            |:|||||||||||||.|:||:||||||||||:||:||||||.:.|:|||||||||
Mouse   207 SITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
amxNP_001245591.1 TM2 219..268 CDD:282945 39/49 (80%)
Tm2d3NP_835157.1 TM2 196..245 CDD:282945 39/49 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C264512343
eggNOG 1 0.900 E1_KOG4272
Hieranoid 1 1.000
Homologene 1 1.000 H12275
Inparanoid 1 1.050 195 1.000 Inparanoid score I3805
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006157
OrthoInspector 1 1.000 T1083599
orthoMCL 1 0.900 OOG5_133979
Panther 1 1.100 LDO PTHR21016
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2847
TreeFam 1 0.960
1211.780

Return to query results.
Submit another query.