DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: amx and Y66D12A.21

Sequence 1:NP_001245591.1 Gene:amx FlyBaseID:FBgn0000077 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_499481.2 Gene:Y66D12A.21 WormBaseID:WBGene00013446 Length:179 Species:Caenorhabditis elegans

Alignment Length:151 Identity:51/152 (34%)
Similarity:78/152 (51%) Gaps:23/152 (15%)


  Fly   139 DLNVTCEVINNVQCLGERSFQRQMNCR-YCYQTEMWQQSCGQRSSCNSATDKLFRTNCTVHHDVL 202
            |..|.|:.::..|.|          |: |...| :.|||.    :|  |.|...:..|.....:.
 Worm    17 DATVKCDDLDPNQYL----------CKNYAVDT-ITQQSV----TC--AADNSIQVMCETAEHIK 64

  Fly   203 CLGNRSF-----TRNLRCNWTQGYRWSTALLISLTLGGFGADRFYLGHWQEGIGKLFSFGGLGVW 262
            |:|...|     |....|::.....::|.:|:|:.||.||.||.|||::..|:.|:||.|||.|:
 Worm    65 CVGKDQFGIFNRTVPSACHYGAHVSYTTTVLLSIFLGFFGIDRIYLGYYALGLIKMFSLGGLFVF 129

  Fly   263 TIIDVLLISMHYLGPADGSLY 283
            .::|::|||:..||||||:.|
 Worm   130 WLVDIILISLQLLGPADGTAY 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
amxNP_001245591.1 TM2 219..268 CDD:282945 21/49 (43%)
Y66D12A.21NP_499481.2 TM2 88..135 CDD:282945 21/47 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5008
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.