DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: amx and tm2d3

Sequence 1:NP_001245591.1 Gene:amx FlyBaseID:FBgn0000077 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_002937906.1 Gene:tm2d3 XenbaseID:XB-GENE-5805754 Length:247 Species:Xenopus tropicalis

Alignment Length:234 Identity:104/235 (44%)
Similarity:135/235 (57%) Gaps:24/235 (10%)


  Fly    72 VSSMVAKSGGG----------AGGLLDNITAYSSSSSSSSSNGNNNMLCPYDKETP----CDRLQ 122
            ::.|...||.|          |..|.|:   :.||:.::|:......:..|.::.|    |.||.
 Frog    17 ITQMYVLSGRGFLSFEYSEPVAQPLKDH---FPSSTIATSTRATATKIPDYMEKCPSNGQCSRLP 78

  Fly   123 FPCIRCNYNHGCIYGRDLNVTCEVINNVQCLGERS-----FQRQMNCRYCYQTEMWQQSCGQRSS 182
            ..|:.|..|:.||||:.:...|...|.|.|....|     |...|.|::|:|.......|...||
 Frog    79 SDCMTCATNYSCIYGKPVTFNCTAKNGVVCFDVNSQPQEYFTISMTCQFCWQLPPSDYVCNLSSS 143

  Fly   183 CN--SATDKLFRTNCTVHHDVLCLGNRSFTRNLRCNWTQGYRWSTALLISLTLGGFGADRFYLGH 245
            |.  |...:.:.|.|||.....|||||:|.:.|.||||.||:|||||.:|:|||||||||||||.
 Frog   144 CKTVSCPRQRYNTTCTVLDHAHCLGNRTFPKMLYCNWTGGYKWSTALALSITLGGFGADRFYLGQ 208

  Fly   246 WQEGIGKLFSFGGLGVWTIIDVLLISMHYLGPADGSLYI 284
            |:||:||||||||||:||:|||.|||:.|:|||||||||
 Frog   209 WREGLGKLFSFGGLGIWTLIDVFLISVGYVGPADGSLYI 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
amxNP_001245591.1 TM2 219..268 CDD:282945 39/49 (80%)
tm2d3XP_002937906.1 TM2 182..231 CDD:282945 39/49 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C264511383
eggNOG 1 0.900 E1_KOG4272
Hieranoid 1 1.000
Homologene 1 1.000 H12275
Inparanoid 1 1.050 197 1.000 Inparanoid score I3597
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385397at2759
OrthoFinder 1 1.000 FOG0006157
OrthoInspector 1 1.000 T601385
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2847
TreeFam 1 0.960
1110.790

Return to query results.
Submit another query.