DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and FOSL1

DIOPT Version :10

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_005429.1 Gene:FOSL1 / 8061 HGNCID:13718 Length:271 Species:Homo sapiens


Alignment Length:232 Identity:50/232 - (21%)
Similarity:96/232 - (41%) Gaps:77/232 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 LTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQKLVDM 264
            ::||:|:|||.||||||:||.|||.:::|.|..|..|::.|:.:...|:.::.:|:.::::|..:
Human   100 ISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELV 164

  Fly   265 LKSHGCQRAGGCQLPSQLLQSPAQKYLSELELETVSIDGPNSGNNNQRLQSIPSMATFKYGSKTA 329
            |::|    ...|::|                      :|...|:                   |.
Human   165 LEAH----RPICKIP----------------------EGAKEGD-------------------TG 184

  Fly   330 AAMAQQLPNGYCKPSPSAQEFEHAGYQQQQQQQQQQQPQSLNPAGNNVIDQQHANPSPSLLSDYV 394
            :......|...|:|.|..                     ||:|   ..:.:..|..:|:|::  .
Human   185 STSGTSSPPAPCRPVPCI---------------------SLSP---GPVLEPEALHTPTLMT--T 223

  Fly   395 PNCDGLTGS------ASNHPSHNNNNNNNNSSGASSN 425
            |:....|.|      ::..|..:.:..:::|||..|:
Human   224 PSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 16/52 (31%)
coiled coil 215..265 CDD:269870 15/49 (31%)
FOSL1NP_005429.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..112 6/11 (55%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 107..127 14/19 (74%)
bZIP_Fos 115..168 CDD:269869 16/52 (31%)
coiled coil 115..167 CDD:269869 16/51 (31%)
PRK13729 129..>250 CDD:184281 28/191 (15%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 133..161 5/27 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..202 8/69 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..271 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.