DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and Batf

DIOPT Version :10

Sequence 1:NP_001259125.1 Gene:Atf3 / 43867 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001100218.1 Gene:Batf / 299206 RGDID:1304923 Length:125 Species:Rattus norvegicus


Alignment Length:103 Identity:36/103 - (34%)
Similarity:57/103 - (55%) Gaps:4/103 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 SDDDSETKSQPKGLTPEDED-RRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQ 250
            |.|.|.::|.|.|.....:| |:.:|||:|:|||.|.|.::.::...|..|||.|:.||..|:.:
  Rat     7 SSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKE 71

  Fly   251 VRQLETERQKLVDMLKSHG--CQ-RAGGCQLPSQLLQS 285
            ::||..|.:....:|.||.  |. .|.|...|.:::.|
  Rat    72 IKQLTEELKYFTSVLSSHEPLCSVLASGTPSPPEVVYS 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 18/52 (35%)
coiled coil 215..265 CDD:269870 17/49 (35%)
BatfNP_001100218.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59 19/51 (37%)
bZIP_BATF 26..83 CDD:269849 22/56 (39%)
coiled coil 28..82 CDD:269849 21/53 (40%)
Basic motif 28..50 10/21 (48%)
Leucine-zipper 54..75 8/20 (40%)

Return to query results.
Submit another query.