DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxd2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_233422.5 Gene:Foxd2 / 313504 RGDID:1304642 Length:494 Species:Rattus norvegicus


Alignment Length:316 Identity:94/316 - (29%)
Similarity:118/316 - (37%) Gaps:110/316 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GGTGG------SGASAPWLHLSPYGH---------------HGSGSLPSVN------RMAALSTI 113
            ||:||      ||..|| ..:.|:||               ..||......      |.||.:..
  Rat    32 GGSGGGELTARSGPRAP-RDVLPHGHELPPEEAEADVAEDEEESGGCSDCEPRALGPRGAAAAAG 95

  Fly   114 SLFPQTQRIFQPEEP--------------------KPQHSYIGLIAMAILSSTDMKLVLSDIYQY 158
            |..|..|.......|                    ||.:|||.||.||||.|...:|.||:|.::
  Rat    96 SPGPGVQAARGATGPGPGPGPGPPSGGAATRSPLVKPPYSYIALITMAILQSPKKRLTLSEICEF 160

  Fly   159 ILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWAIHPANMEDFRKGDFRRRKA 221
            |...:||:|.:.|.|:|||||||||||||:|..|...  |||:||.:.|.:.:.|..|.|.||:.
  Rat   161 ISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRK 225

  Fly   222 QRKVRKHMGLSVDDASTDSPSPPPLDLTTPPPPSSQSALQL----SALGYPYHQHYIGQFFNRSS 282
            :.|              ..|.|||     .|.|.....|.|    :|.|.|      |.|.:..:
  Rat   226 RFK--------------RQPLPPP-----HPHPHPHPELLLRGGAAAAGDP------GAFLSGFA 265

  Fly   283 APGMTHYS-----------PPDPALLMQRQEANNLDQTIQPTQLQQPHSHHQHFAY 327
            |.|...|.           ||.||                    ..||.|...||:
  Rat   266 AYGAYGYGYGLALPAYGAPPPGPA--------------------PHPHPHPHAFAF 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/85 (52%)
Foxd2XP_233422.5 FH_FOXD1_D2-like 131..229 CDD:410820 49/111 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.