DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fd102C and Foxd2

Sequence 1:NP_651951.1 Gene:fd102C FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_233422.4 Gene:Foxd2 RGDID:1304642 Length:494 Species:Rattus norvegicus

Alignment Length:316 Identity:94/317 (30%)
Similarity:118/317 (37%) Gaps:110/317 (35%)


  Fly    76 GGTGG------SGASAPWLHLSPYGH---------------HGSGSLPSVN------RMAALSTI 113
            ||:||      ||..|| ..:.|:||               ..||......      |.||.:..
  Rat    32 GGSGGGELTARSGPRAP-RDVLPHGHELPPEEAEADVAEDEEESGGCSDCEPRALGPRGAAAAAG 95

  Fly   114 SLFPQTQRIFQPEEP--------------------KPQHSYIGLIAMAILSSTDMKLVLSDIYQY 158
            |..|..|.......|                    ||.:|||.||.||||.|...:|.||:|.::
  Rat    96 SPGPGVQAARGATGPGPGPGPGPPSGGEATRSPLVKPPYSYIALITMAILQSPKKRLTLSEICEF 160

  Fly   159 ILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWAIHPANMEDFRKGDFRRRKA 221
            |...:||:|.:.|.|:|||||||||||||:|..|...  |||:||.:.|.:.:.|..|.|.||:.
  Rat   161 ISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRK 225

  Fly   222 QRKVRKHMGLSVDDASTDSPSPPPLDLTTPPPPSSQSALQL----SALGYPYHQHYIGQFFNRSS 282
            :.|              ..|.|||     .|.|.....|.|    :|.|.|      |.|.:..:
  Rat   226 RFK--------------RQPLPPP-----HPHPHPHPELLLRGGAAAAGDP------GAFLSGFA 265

  Fly   283 APGMTHYS-----------PPDPALLMQRQEANNLDQTIQPTQLQQPHSHHQHFAY 327
            |.|...|.           ||.||                    ..||.|...||:
  Rat   266 AYGAYGYGYGLALPAYGAPPPGPA--------------------PHPHPHPHAFAF 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/86 (51%)
Foxd2XP_233422.4 Forkhead 131..217 CDD:278670 44/86 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1270467at2759
OrthoFinder 1 1.000 FOG0000015
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.