DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fd102C and foxk2

Sequence 1:NP_651951.1 Gene:fd102C FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001135634.1 Gene:foxk2 XenbaseID:XB-GENE-483520 Length:645 Species:Xenopus tropicalis

Alignment Length:630 Identity:151/631 (24%)
Similarity:224/631 (35%) Gaps:204/631 (32%)


  Fly    14 ADQDQGTSSRDSNVPKPSLPNIYPLGTTRTSQAQSTTMTLEQYRLQLYNYALNIERLRCPQYGGT 78
            :|:.|...:.:|.| ||..|.|.||           |:.:..      |.|..|..|..|.  ||
 Frog   122 SDKKQKLEAPESPV-KPVQPQISPL-----------TINIPD------NMAHLISPLPSPT--GT 166

  Fly    79 GGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQR-------IFQPEEPKPQHSYIG 136
            ..:..|.|   .||.|...||.  .:.|:.....|:...|::.       ....::.||.:||..
 Frog   167 ISAANSCP---SSPRGAGSSGF--KLGRVIPPDLIAEAAQSENDKDASGGDSPKDDSKPPYSYAQ 226

  Fly   137 LIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGH 199
            ||..||..:.|.:|.|:.||.:|..||||:|:...||:||||||||||..|||..||..  |||.
 Frog   227 LIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGS 291

  Fly   200 YWAIHPANMEDFRKGDFRRRK--------------AQRKV---RKHMG-LSVDDASTDSP----- 241
            :|.|.||:.....:..||:|:              :.|..   ..|.| ||...:...:|     
 Frog   292 FWRIDPASESKLVEQAFRKRRPRGVPCFRTPLGPLSSRSAPASPNHAGVLSAHSSGLQTPESLSR 356

  Fly   242 --SPPPLDLTTPPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEAN 304
              ||.|::   |.|.:.|..|.:           |.:.....|||| :..|.....:.:|||   
 Frog   357 EGSPIPME---PEPSAIQPKLAV-----------IQEARFAQSAPG-SPLSSQQVLIAVQRQ--- 403

  Fly   305 NLDQTIQPTQLQQPHSHHQHFAYINSTTTTTIANMFSQTRKRQFDVASLLAPDVQIVDIVSEDQE 369
             |.|||:|                   .|.|:|                                
 Frog   404 -LPQTIKP-------------------VTYTVA-------------------------------- 416

  Fly   370 SSVTPTTSARTTTQTHHTVITKQTIHREVVLGLEKPVQDADIDADIDVEVNVDVVDDSIIPDTDS 434
            :.||..||.:...||.|.|.....:....|.|| .|:                            
 Frog   417 TPVTTATSQQALMQTVHVVHQIPAVSVTNVTGL-TPI---------------------------- 452

  Fly   435 YTDGEDRKKTRGTLKQIFSIEDNNSYLIDGRLSSFDADPDHDPDHDPEDLEQH-NFSIASSAARS 498
                                   |:|.:.|:.....|.....|..:|::...| ...:...|..:
 Frog   453 -----------------------NTYTVGGQAMVAQAAVMAQPKLEPQENGDHKEVKVKVEAIPA 494

  Fly   499 LG----SSSSQHEESSSLEECPIQECIVAPQTAL----ISSMATAKTSTLSVPISDAYLELNQVD 555
            :|    :::|:..::||  ..|:|...:..||.|    :...|..:..|..|||:.|.  ..||.
 Frog   495 IGHPALTTASRIIQTSS--SAPLQTVTIVQQTPLGQHQLPIKAVTQNGTHVVPITTAI--QGQVT 555

  Fly   556 QHMLS--------RYYGSYIAAAARRASIDASNTSRTSSITPPPK 592
            ....|        ::.|:...|||....:.|::.|.::|:  |.|
 Frog   556 TANSSYSLIESPWQWRGNGTRAAASPLHMLATHASASASL--PTK 598

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 43/86 (50%)
foxk2NP_001135634.1 FHA 10..117 CDD:238017
Forkhead 219..305 CDD:278670 43/86 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2114
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.