DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 4E-T and EIF4ENIF1

Sequence 1:NP_726618.3 Gene:4E-T FlyBaseID:FBgn0052016 Length:1010 Species:Drosophila melanogaster
Sequence 2:XP_006724344.3 Gene:EIF4ENIF1 HGNCID:16687 Length:1027 Species:Homo sapiens

Alignment Length:1193 Identity:247/1194 (21%)
Similarity:391/1194 (33%) Gaps:431/1194 (36%)


  Fly     4 SKISARYSKVDLLALRYEGKSRQRPQCSTRLELQTLGFWKINLNTAALTVSSAYSNQNKN-RLSP 67
            ||...||:|.:||.::....|:|||.|.:. :..:.|.|......|:|..:|..|:..:: :...
Human    65 SKCPHRYTKEELLDIKELPHSKQRPSCLSE-KYDSDGVWDPEKWHASLYPASGRSSPVESLKKEL 128

  Fly    68 EADNSSLICSNSSSISSRRAMRNRERANNYYQRFVPTDSLLISGEDKDKDALSHGQPYKLNIIDH 132
            :.|..||:         ||.:..|||.                 ::.|.|.:...|        .
Human   129 DTDRPSLV---------RRIVDPRERV-----------------KEDDLDVVLSPQ--------R 159

  Fly   133 RSISSS-HLMPAFAKRRFVISKGSNSEESNEGINTCASKGKAASSPSRKGSELDTAETCLNFVQP 196
            ||.... |:..|.:.||    .||..|:.::|:.....                           
Human   160 RSFGGGCHVTAAVSSRR----SGSPLEKDSDGLRLLGG--------------------------- 193

  Fly   197 DHDQCMSSSPTFSTSRQERRIGSGRLLPRSDNWDYKNEKTVEASIENEKETSPNGSGSTSSLNQH 261
                              |||||||::         :.:|.|                    ..|
Human   194 ------------------RRIGSGRII---------SARTFE--------------------KDH 211

  Fly   262 NQSQHRSRTFSGRLVERVPEVTDRRFQYDSKKSFDRQGINNRRISGKEPFSTQSRSKRGNSYLIH 326
            ..|....|....|  :|..:..|:||:        |:..:::|:.|:.        :|.:|| ..
Human   212 RLSDKDLRDLRDR--DRERDFKDKRFR--------REFGDSKRVFGER--------RRNDSY-TE 257

  Fly   327 EEPEWFSAGPKSQLETIDLHGFED--LEKNEE-RSVTEDKNNQIQQ--LDKNLDAQASKDEASMR 386
            ||||||||||.||.|||:|.||:|  ||::.: |..|..:...:::  ::.| ...|.:||.   
Human   258 EEPEWFSAGPTSQSETIELTGFDDKILEEDHKGRKRTRRRTASVKEGIVECN-GGVAEEDEV--- 318

  Fly   387 NSNDSLNFREVIPSDEKKHTDENVVTSIQNSTDLGHPNKNKPIQMQPSQNPESEFNFDAFLNMH- 450
                     |||.:.|.. .|:.|...                .:.|.|:| .:|:|:.|.|:. 
Human   319 ---------EVILAQEPA-ADQEVPRD----------------AVLPEQSP-GDFDFNEFFNLDK 356

  Fly   451 -PLDNSVLSNDETGKSDSKGTSRFSRWFRQKEAANNNE----------------------FPGFR 492
             |...|:: .|..|:. |...|||||||.....:.:..                      .||..
Human   357 VPCLASMI-EDVLGEG-SVSASRFSRWFSNPSRSGSRSSSLGSTPHEELERLAGLEQAILSPGQN 419

  Fly   493 ----------ESHAQEKRGIPSVKDLE-AQMIKVDMRTDLINPIAGSLCQTVQMEKPIA------ 540
                      |.||:.|     |..|| .|..|||::     |:..||....:..|..:      
Human   420 SGNYFAPIPLEDHAENK-----VDILEMLQKAKVDLK-----PLLSSLSANKEKLKESSHSGVVL 474

  Fly   541 --RDTEAFKKLLQQLGSQARQHHPCNDDCRTINLSNIANHVHLESKLHQKINDGHL--------- 594
              .:.||..|.| ::..|.:...|...:.....||.:.|:..|:       .||.:         
Human   475 SVEEVEAGLKGL-KVDQQVKNSTPFMAEHLEETLSAVTNNRQLK-------KDGDMTAFNKLVST 531

  Fly   595 --------QQPELSVN----------VPTMPTSSHV----------------------------- 612
                    .||::|.|          :|..|...::                             
Human   532 MKASGTLPSQPKVSRNLESHLMSPAEIPGQPVPKNILQELLGQPVQRPASSNLLSGLMGSLEPTT 596

  Fly   613 -FLQKRLEIQHLIQRLHCGDVSHDFLEKELDNP--STPAATKDVIATVLNEYSHSKRNPV--VTG 672
             .|.:|.....|.|.......|.|:|...:.:|  .||...:     :|.:.....|.|:  :|.
Human   597 SLLGQRAPSPPLSQVFQTRAASADYLRPRIPSPIGFTPGPQQ-----LLGDPFQGMRKPMSPITA 656

  Fly   673 D-----------------PN-------IFTQQSFLQPQ-----SVHQHYSQELHSQNTANHTINQ 708
            .                 |:       .|.|..|.:||     ...::..|.:.......|..| 
Human   657 QQMSQLELQQAALEGLALPHDLAVQAANFYQPGFGKPQVDRTRDGFRNRQQRVTKSPAPVHRGN- 720

  Fly   709 LISHGNSPTPLA---------FTPTSVLRKMTADKDTQSPSTYCQNPQYHVHQQNAKQVGTRENV 764
                .:||.|.|         ||||||:|||                 |...:::.::..:.:..
Human   721 ----SSSPAPAASITSMLSPSFTPTSVIRKM-----------------YESKEKSKEEPASGKAA 764

  Fly   765 LEPQLTATMAVQPRMILGGGNFAIGQNNQHLSPNMSQSRNQ---------QVLKWTSGNMQMVHG 820
            |......|.......:|...:......:...:.|...|..|         |..::|  ..|....
Human   765 LGDSKEDTQKASEENLLSSSSVPSADRDSSPTTNSKLSALQRSSCSTPLSQANRYT--KEQDYRP 827

  Fly   821 KTFGR--PILKGGLNSMPHSNSA--LPFTAHKIEMQPIHQPH-------LQQQQHRFKAVQSVES 874
            |..||  |.|...:.:.|.....  :|...|...::|.||.|       |.|..|    .|.:.|
Human   828 KATGRKTPTLASPVPTTPFLRPVHQVPLVPHVPMVRPAHQLHPGLVQRMLAQGVH----PQHLPS 888

  Fly   875 NLNT-------ESVH-QNITSPVGWHQLYMQHQQQH-----------H--HTRQQLSQRVIY--- 915
            .|.|       :..| |.|:.|:.....|......|           |  ..:|||.:.|::   
Human   889 LLQTGVLPPGMDLSHLQGISGPILGQPFYPLPAASHPLLNPRPGTPLHLAMVQQQLQRSVLHPPG 953

  Fly   916 -----GEMHRQSNPQMSPPVPGFSDSSDSGNVIKANSLTSPSYQRDERISSPTNQLAQWFSPELL 975
                 ..:..|:.||..|        |.||.....:.|   .::..:|.|||.. ||:||..::|
Human   954 SGSHAAAVSVQTTPQNVP--------SRSGLPHMHSQL---EHRPSQRSSSPVG-LAKWFGSDVL 1006

  Fly   976 AKASAGKLPLLNVNQALSLEEFE 998
            .:    .||.:.. :.:|::|.|
Human  1007 QQ----PLPSMPA-KVISVDELE 1024

Known Domains:


GeneSequenceDomainRegion External IDIdentity
4E-TNP_726618.3 EIF4E-T 10..736 CDD:287454 182/875 (21%)
EIF4ENIF1XP_006724344.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C329536887
eggNOG 1 0.900 E1_28JBG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005826
OrthoInspector 1 1.000 T1073203
orthoMCL 1 0.900 OOG5_134089
Panther 1 1.100 LDO PTHR12269
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7859
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.