DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fuss and Skor2

Sequence 1:NP_001162829.1 Gene:fuss FlyBaseID:FBgn0039932 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_006222695.1 Gene:Skor2 RGDID:1598071 Length:1008 Species:Rattus norvegicus

Alignment Length:308 Identity:187/309 (61%)
Similarity:221/309 (72%) Gaps:19/309 (6%)


  Fly    28 RSNHVSSVLLYGVQIVSLHIEGQERLCLAQISNTLLKQFSYNEIHNRRVALGITCVQCTPVQLEI 92
            :.|.|..|:|||:.||||.|:||||||||||||||||.|||||||||||||||||||||||||||
  Rat    37 KPNQVGQVILYGIPIVSLVIDGQERLCLAQISNTLLKNFSYNEIHNRRVALGITCVQCTPVQLEI 101

  Fly    93 LRRAGAMPVSSRRCGMITRREAERLCKSFLGDNTPPRLPDDFAFNVQHKCAWGCRGSFLPSRYNS 157
            ||||||||:|||||||||:||||||||||||:|.||:|||:|||:|.|:|||||||||:|:||||
  Rat   102 LRRAGAMPISSRRCGMITKREAERLCKSFLGENRPPKLPDNFAFDVSHECAWGCRGSFIPARYNS 166

  Fly   158 SRAKCIKCSYCGMFFSPNKFIFHSHRITTNDRYVQPDAANFNSWRRHMSLSGNDYDEKIIHAWED 222
            |||||||||||.|:|||||||||||| |.:.:|.|||||||||||||:.|:.....::::.||||
  Rat   167 SRAKCIKCSYCNMYFSPNKFIFHSHR-TPDAKYTQPDAANFNSWRRHLKLTDKSPQDELVFAWED 230

  Fly   223 VKAMFNGGTRKR-LVGSSINPR-SPGSPTQSTAVSSGVGSSSCGS-----------PTSFERDTN 274
            ||||||||:||| |...|.:|. .|.|..::.||::....:..|.           |........
  Rat   231 VKAMFNGGSRKRALPQPSAHPACHPLSSVKAAAVAAAAAVAGGGGLLGPHLLGAPPPPPPPPPLA 295

  Fly   275 EVDG--KSGSSLPQRSQIDSQYNYGTVAAAAAVVGVTA---VAAATVG 317
            |:.|  .:....|:....|.......|.|||::....|   |||||.|
  Rat   296 ELAGAPHAHHKRPRFDDDDDSLQEAAVVAAASLSAAAASLSVAAATGG 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fussNP_001162829.1 Ski_Sno 25..123 CDD:280577 82/95 (86%)
c-SKI_SMAD_bind 135..228 CDD:198114 67/93 (72%)
Skor2XP_006222695.1 Ski_Sno 39..132 CDD:280577 82/93 (88%)
c-SKI_SMAD_bind 145..235 CDD:285935 65/91 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C3ZR
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10005
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
43.960

Return to query results.
Submit another query.