DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fuss and SKOR2

Sequence 1:NP_001162829.1 Gene:fuss FlyBaseID:FBgn0039932 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001264992.1 Gene:SKOR2 HGNCID:32695 Length:1015 Species:Homo sapiens

Alignment Length:315 Identity:187/316 (59%)
Similarity:223/316 (71%) Gaps:32/316 (10%)


  Fly    28 RSNHVSSVLLYGVQIVSLHIEGQERLCLAQISNTLLKQFSYNEIHNRRVALGITCVQCTPVQLEI 92
            :.|.|..|:|||:.||||.|:||||||||||||||||.|||||||||||||||||||||||||||
Human    37 KPNQVGQVILYGIPIVSLVIDGQERLCLAQISNTLLKNFSYNEIHNRRVALGITCVQCTPVQLEI 101

  Fly    93 LRRAGAMPVSSRRCGMITRREAERLCKSFLGDNTPPRLPDDFAFNVQHKCAWGCRGSFLPSRYNS 157
            ||||||||:|||||||||:||||||||||||:|.||:|||:|||:|.|:|||||||||:|:||||
Human   102 LRRAGAMPISSRRCGMITKREAERLCKSFLGENRPPKLPDNFAFDVSHECAWGCRGSFIPARYNS 166

  Fly   158 SRAKCIKCSYCGMFFSPNKFIFHSHRITTNDRYVQPDAANFNSWRRHMSLSGNDYDEKIIHAWED 222
            |||||||||||.|:|||||||||||| |.:.:|.|||||||||||||:.|:.....::::.||||
Human   167 SRAKCIKCSYCNMYFSPNKFIFHSHR-TPDAKYTQPDAANFNSWRRHLKLTDKSPQDELVFAWED 230

  Fly   223 VKAMFNGGTRKRLVGSSINPRSPGS-----PTQS---------TAVSSG---VGSSSCGSPTSFE 270
            ||||||||:|||.:     |: ||:     |..|         .||:.|   :|....|:|....
Human   231 VKAMFNGGSRKRAL-----PQ-PGAHPACHPLSSVKAAAVAAAAAVAGGGGLLGPHLLGAPPPPP 289

  Fly   271 RDTNEVDGKSGS-----SLPQRSQIDSQYNYGTVAAAAAVVGVTA---VAAATVG 317
            .....:...:|:     ..|:....|.......|.|||::....|   ||||:.|
Human   290 PPPPPLAELAGAPHAHHKRPRFDDDDDSLQEAAVVAAASLSAAAASLSVAAASGG 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fussNP_001162829.1 Ski_Sno 25..123 CDD:280577 82/95 (86%)
c-SKI_SMAD_bind 135..228 CDD:198114 67/93 (72%)
SKOR2NP_001264992.1 Ski_Sno 39..132 CDD:280577 82/93 (88%)
c-SKI_SMAD_bind 145..235 CDD:285935 65/91 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C3ZR
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006061
OrthoInspector 1 1.000 T608550
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10005
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5040
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.