| Sequence 1: | NP_001162829.1 | Gene: | fuss / 43835 | FlyBaseID: | FBgn0039932 | Length: | 770 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097115.1 | Gene: | Snoo / 5740414 | FlyBaseID: | FBgn0085450 | Length: | 1223 | Species: | Drosophila melanogaster | 
| Alignment Length: | 739 | Identity: | 155/739 - (20%) | 
|---|---|---|---|
| Similarity: | 255/739 - (34%) | Gaps: | 220/739 - (29%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    37 LYGVQIVSLHIEGQERLCLAQISNTLLKQFSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPV 101 
  Fly   102 SSRRCGMITRREAERLCKSFL-GDNTPPRLPDD------FAFNVQHKCAWGCRGSFLPSRYNSSR 159 
  Fly   160 AKCIKCSYCGMFFSPNKFIFHSHRITTNDR-YVQPDAANFNSWRRHMSLSGNDYDE--------K 215 
  Fly   216 IIHAWEDVKAMFNGGTRKR-------------------------LVGSSINPRSPGSPTQSTAVS 255 
  Fly   256 SG-------VGSSSCGSPTSF------------ERDTNEVDGKSGSSLPQRSQIDSQYNYGTVAA 301 
  Fly   302 AAAVVGVTAVAAATVGVP----------------------------FNLHGSTV----------- 327 
  Fly   328 --------------------------LSPLHS-LRNERDLSIMPISRNFVVDYMWQQKDQHYQQP 365 
  Fly   366 YARK-------IPSGDNSDS---SLDFDSWVKP------DSNNPIP------------------- 395 
  Fly   396 ---NANSVRTSDNCSFNIKNE--SHSSIYGIIKNHKLSGVPNSGLNLSDYNIPSILNCSAFKPVV 455 
  Fly   456 ASTAIV----STSLYTRSNESTRTDCNNPAQSTRTTTVLTHNSISASSHQIVGHKTFSPILGKIH 516 
  Fly   517 SNPEKNRIVSVFASSSTGNADDNDDDDEVVDIETTEDEGKFTVQHADSPKTQYDAISGSDSPSRS 581 
  Fly   582 PSTSTNIDVEQDVDVDIITTDTED 605 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| fuss | NP_001162829.1 | Ski_Sno | 25..123 | CDD:280577 | 35/86 (41%) | 
| c-SKI_SMAD_bind | 135..228 | CDD:198114 | 31/101 (31%) | ||
| Snoo | NP_001097115.1 | Ski_Sno | 114..207 | CDD:280577 | 34/85 (40%) | 
| c-SKI_SMAD_bind | 226..317 | CDD:198114 | 28/91 (31%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR10005 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||