DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fuss and Snoo

Sequence 1:NP_001162829.1 Gene:fuss FlyBaseID:FBgn0039932 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001097115.1 Gene:Snoo FlyBaseID:FBgn0085450 Length:1223 Species:Drosophila melanogaster

Alignment Length:739 Identity:155/740 (21%)
Similarity:255/740 (34%) Gaps:220/740 (30%)


  Fly    37 LYGVQIVSLHIEGQERLCLAQISNTLLKQFSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPV 101
            |.|..|....:.|:.||||.|..|.:|..||..:|:.....|||.|.|||..||...:.|..:|.
  Fly   121 LEGKTIGCFSVGGEMRLCLPQFLNNVLNDFSLEQINRIFDELGIYCSQCTHDQLVEFKAAKILPS 185

  Fly   102 SSRRCGMITRREAERLCKSFL-GDNTPPRLPDD------FAFNVQHKCAWGCRGSFLPSRYNSSR 159
            ..:..|:|||.:|||||.:.| ..:....:|.:      .:|:|.|||...|.|...|..|:..:
  Fly   186 DVKASGLITRTDAERLCAALLH
RSDRNSYVPIESLAKGALSFHVYHKCFGKCEGICTPDMYSYQK 250

  Fly   160 AKCIKCSYCGMFFSPNKFIFHSHRITTNDR-YVQPDAANFNSWRRHMSLSGNDYDE--------K 215
            ..||||..|..:|||.||:.|.||...|.. :...|:.|::.: .|::|...:.::        |
  Fly   251 PTCIKCLECDGWFSPQKFVGHVHRKFENHTCHWGFDSRNWHDY-LHVALDVENREKYQIILDQLK 314

  Fly   216 IIHAWEDVKAMFNGGTRKR-------------------------LVGSSINPRSPGSPTQSTAVS 255
            .:...|..||......:||                         |||:...|..|........:.
  Fly   315 EVELKEMHKAQRELEHKKRKAEMLMDDGMLGSGPVLGLAGHPHGLVGALAPPPPPPMKQPQMDIP 379

  Fly   256 SG-------VGSSSCGSPTSF------------ERDTNEVDGKSGSSLPQRSQIDSQYNYGTVAA 301
            ||       .|::...|...:            ||:      :....||....:..|:.      
  Fly   380 SGKKQLQQLKGATVAASALEYQYQVMYAHCVQKERE------REREHLPHSHPLPRQHR------ 432

  Fly   302 AAAVVGVTAVAAATVGVP----------------------------FNLHGSTV----------- 327
                    ||..||...|                            .:.:|:|:           
  Fly   433 --------AVLVATTPYPHLPQYPTPPTLNSSSAFRPWGPDTTKAFLHAYGATLSSLPYACQEPP 489

  Fly   328 --------------------------LSPLHS-LRNERDLSIMPISRNFVVDYMWQQKDQHYQQP 365
                                      |:|..| |..|||.....:.|..:.....::|:..:|..
  Fly   490 ELQNPERVVRSTDKRYAERTYQPNVALAPRKSILSKERDKDRERMEREVMERQRLREKETDHQVV 554

  Fly   366 YARK-------IPSGDNSDS---SLDFDSWVKP------DSNNPIP------------------- 395
            :.::       .|:....|.   .||.   |:|      .||:|:|                   
  Fly   555 HIKQERSQTPTPPTASPPDGVVLPLDV---VEPPHPSSSGSNSPLPAHLPAAPATAPPNAGGAPP 616

  Fly   396 ---NANSVRTSDNCSFNIKNE--SHSSIYGIIKNHKLSGVPNSGLNLSDYNIPSILNCSAFKPVV 455
               |..::|:.:..|....||  |.:|.:....:|.....|.:|......:|.:.:|..| |.:.
  Fly   617 TPTNLRNMRSPEEFSAGGSNEITSSTSPHHQQSSHHQVVQPTAGAPPPSQHIIATVNQHA-KLLP 680

  Fly   456 ASTAIV----STSLYTRSNESTRTDCNNPAQSTRTTTVLTHNSISASSHQIVGHKTFSPILGKIH 516
            :|:::.    |:||...:||.:|...|....|.:  .|:..:.::...||  .|.|.   :....
  Fly   681 SSSSLPNGNGSSSLAATNNEPSRIRINKNLMSQQ--PVVAVSGMTPHHHQ--HHPTH---MHHFS 738

  Fly   517 SNPEKNRIVSVFASSSTGNADDNDDDDEVVDIETTEDEGKFTVQHADSPKTQYDAISGSDSPSRS 581
            ....|::..|...|||.|           :::.|.......:..||..|||.:.::...:...::
  Fly   739 HGYYKSQASSPTQSSSAG-----------LNLSTHSSNVVSSPHHATQPKTHHSSVGSGNHGLQN 792

  Fly   582 PSTSTNIDVEQDVDVDIITTDTED 605
            .......:.|       ::|||:|
  Fly   793 GKPHLGSEFE-------LSTDTDD 809

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fussNP_001162829.1 Ski_Sno 25..123 CDD:280577 35/87 (40%)
c-SKI_SMAD_bind 135..228 CDD:198114 31/102 (30%)
SnooNP_001097115.1 Ski_Sno 114..207 CDD:280577 35/86 (41%)
c-SKI_SMAD_bind 226..317 CDD:198114 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10005
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.