DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fuss and skor1b

Sequence 1:NP_001162829.1 Gene:fuss FlyBaseID:FBgn0039932 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001038598.1 Gene:skor1b ZFINID:ZDB-GENE-050419-82 Length:751 Species:Danio rerio

Alignment Length:812 Identity:278/813 (34%)
Similarity:372/813 (46%) Gaps:234/813 (29%)


  Fly    28 RSNHVSSVLLYGVQIVSLHIEGQERLCLAQISNTLLKQFSYNEIHNRRVALGITCVQCTPVQLEI 92
            :.|.||...|||:.||||.|:||||||||||||||||.:||||||||||||||||||||||||||
Zfish    32 KPNQVSETSLYGIPIVSLVIDGQERLCLAQISNTLLKNYSYNEIHNRRVALGITCVQCTPVQLEI 96

  Fly    93 LRRAGAMPVSSRRCGMITRREAERLCKSFLGDNTPPRLPDDFAFNVQHKCAWGCRGSFLPSRYNS 157
            ||||||||:|||||||||:||||||||||||.::||:||::|||:|.|:||||.||:|:|:||||
Zfish    97 LRRAGAMPISSRRCGMITKREAERLCKSFLGAHSPPKLPENFAFDVSHECAWGSRGNFIPARYNS 161

  Fly   158 SRAKCIKCSYCGMFFSPNKFIFHSHRITTNDRYVQPDAANFNSWRRHMSLSGNDYDEKIIHAWED 222
            |||||||||:|.|:|||||||||||| |...:|.|||||||||||||:.||..:..:.:||||||
Zfish   162 SRAKCIKCSFCNMYFSPNKFIFHSHR-TPESKYTQPDAANFNSWRRHLKLSDKNSSDDVIHAWED 225

  Fly   223 VKAMFNGGTRKRLVGSSINPRSPGSP--------------------------TQSTAVSS----G 257
            ||||||||:|||.:....:..||..|                          |..:::.|    .
Zfish   226 VKAMFNGGSRKRTLPIGRSESSPSQPPRGQTQGEPSDVPHKTLRCEDDRVNVTMPSSIRSYPVIP 290

  Fly   258 VGSSSCG-----------SPTSF-------ERDTNEVDGK------SGSSLPQRSQIDSQYN--- 295
            |.|.|.|           .|..|       ::|..||.|:      ||...|  |..||.|.   
Zfish   291 VPSKSFGMLQKIPPPLFPHPYGFPAFGLCQKKDDGEVMGEPNKTNLSGVFWP--SPKDSAYTSFP 353

  Fly   296 --YGTVAAAAAVVGVTAVAAATVGVPFNLHG-----STVLSPLHSLRNERDLSIMPISRNFVVDY 353
              :.|..:.|              :|...|.     |.||...|   ||.|:|            
Zfish   354 MFWPTTGSLA--------------MPTYHHAQPKPPSDVLCARH---NELDVS------------ 389

  Fly   354 MWQQKDQHYQQPYARKIPSGDNSDSSLDFDSWVKPDSNNPIPNANSVRTSDNCSFNIKNESHSSI 418
              :|.|:....|          .||.||         |....:..|.|..::.|   .:||.|  
Zfish   390 --EQSDRSTSTP----------KDSLLD---------NERCSSTQSTRNEEDKS---GDESRS-- 428

  Fly   419 YGIIKNHKLSGVPNSGLNLSDYNIPSILNCSAFKPVVASTAIVSTSLYTRSNESTRTDCNNPAQS 483
                    :.|:|.:...:|        ..|||:|||.....:: .||     ..|...:.|...
Zfish   429 --------IEGIPPTSRKIS--------YISAFRPVVKDVESIA-KLY-----GNRGPYSGPRSG 471

  Fly   484 TRTTTVLTHNSISASSHQIVGHKTFSPILGKIHSNPEKNRIVSVFASSSTGNADDNDDDDEVVDI 548
            ..:...|:.:|         .:::.||                        :.|..||.|  ||:
Zfish   472 YMSPDFLSESS---------SYRSVSP------------------------DVDSVDDPD--VDV 501

  Fly   549 ET---TEDEG--KFTVQHADSPKT----QYDAISGSDSPSRSPST-----STNIDVEQDVDVDII 599
            |:   .|||.  :.:|....||.:    |.:.:.|.|..:....|     |||....:..|::..
Zfish   502 ESHKAHEDEECLQLSVDDRRSPHSLTLAQSEGVKGQDQENTQMHTLNDLHSTNSSETRPSDMESH 566

  Fly   600 TTDTEDQLELSVGRYSTENTSH----SLSFFQA-----EKIQISDLSPNTKTSSGDN-ETNTLKD 654
            ......:.|:    |:.|...|    |.|:|.:     .:..:.|:.....:|:.:. |....:|
Zfish   567 GNKHTTRFEV----YARERDEHVHQMSTSYFGSATTYQRETSVKDVHEEEPSSTVEEMEPKNHQD 627

  Fly   655 AKGINGNLQILARRKRNKLQKDRCLSKRTVSKCVSDK-SL----IKGLAANELSSSLQIQQHV-- 712
            ...|:        .:|.|...|.|..:..:.|...:: ||    |:.:|..||...|..|..:  
Zfish   628 ENNIS--------EERLKEPNDVCADEEAICKDTGNRGSLIEKNIESMAKEELQKQLVEQVELRK 684

  Fly   713 -----------AFPVFLKSQLHSLRPQQAQQV 733
                       :|...:|.:| |.|.:..||:
Zfish   685 KLEREFQNLKDSFQDQMKREL-SYREEMVQQL 715

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fussNP_001162829.1 Ski_Sno 25..123 CDD:280577 81/95 (85%)
c-SKI_SMAD_bind 135..228 CDD:198114 67/93 (72%)
skor1bNP_001038598.1 Ski_Sno 34..127 CDD:280577 81/93 (87%)
c-SKI_SMAD_bind 140..230 CDD:285935 65/91 (71%)
RILP-like <670..>716 CDD:304877 11/48 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C3ZR
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006061
OrthoInspector 1 1.000 T596069
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10005
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.