DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fuss and SKOR1

Sequence 1:NP_001162829.1 Gene:fuss FlyBaseID:FBgn0039932 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001352844.1 Gene:SKOR1 HGNCID:21326 Length:965 Species:Homo sapiens

Alignment Length:294 Identity:179/295 (61%)
Similarity:204/295 (69%) Gaps:21/295 (7%)


  Fly    28 RSNHVSSVLLYGVQIVSLHIEGQERLCLAQISNTLLKQFSYNEIHNRRVALGITCVQCTPVQLEI 92
            :.|.|....||||.||||.|:||||||||||||||||.:||||||||||||||||||||||||||
Human    73 KPNQVGETSLYGVPIVSLVIDGQERLCLAQISNTLLKNYSYNEIHNRRVALGITCVQCTPVQLEI 137

  Fly    93 LRRAGAMPVSSRRCGMITRREAERLCKSFLGDNTPPRLPDDFAFNVQHKCAWGCRGSFLPSRYNS 157
            ||||||||:|||||||||:||||||||||||::.||:||::|||:|.|:||||.||||:|:||||
Human   138 LRRAGAMPISSRRCGMITKREAERLCKSFLGEHKPPKLPENFAFDVVHECAWGSRGSFIPARYNS 202

  Fly   158 SRAKCIKCSYCGMFFSPNKFIFHSHRITTNDRYVQPDAANFNSWRRHMSLSGNDYDEKIIHAWED 222
            ||||||||.||.|:|||||||||||| |.:.:|.|||||||||||||:.||.....:::.|||||
Human   203 SRAKCIKCGYCSMYFSPNKFIFHSHR-TPDAKYTQPDAANFNSWRRHLKLSDKSATDELSHAWED 266

  Fly   223 VKAMFNGGTRKRLV------GSSINPRSPGSPTQSTAVSSGVGSSSCGSP--------TSFERDT 273
            ||||||||||||..      |...|..| |...:..|...|.|...||:.        .|.....
Human   267 VKAMFNGGTRKRTFSLQGGGGGGANGGS-GGQGKGGAGGGGGGGPGCGAEMAPGPPPHKSLRCGE 330

  Fly   274 NEVDGKSGSSLPQRSQIDSQYNYGTVAAAAAVVG 307
            :|..|..|...|.     .|...|....|:...|
Human   331 DEAAGPPGPPPPH-----PQRGLGLATGASGPAG 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fussNP_001162829.1 Ski_Sno 25..123 CDD:280577 81/95 (85%)
c-SKI_SMAD_bind 135..228 CDD:198114 67/93 (72%)
SKOR1NP_001352844.1 Ski_Sno 75..168 CDD:308187 81/93 (87%)
c-SKI_SMAD_bind 180..272 CDD:198114 67/93 (72%)
DNA_pol3_gamma3 <659..846 CDD:331207
PKK 854..>935 CDD:315199
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C3ZR
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T608550
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10005
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5040
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.