DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fuss and Skor1

Sequence 1:NP_001162829.1 Gene:fuss FlyBaseID:FBgn0039932 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_006226487.2 Gene:Skor1 RGDID:1307687 Length:964 Species:Rattus norvegicus

Alignment Length:938 Identity:285/939 (30%)
Similarity:365/939 (39%) Gaps:335/939 (36%)


  Fly    28 RSNHVSSVLLYGVQIVSLHIEGQERLCLAQISNTLLKQFSYNEIHNRRVALGITCVQCTPVQLEI 92
            :.|.|....||||.||||.|:||||||||||||||||.:||||||||||||||||||||||||||
  Rat    73 KPNQVGETSLYGVPIVSLVIDGQERLCLAQISNTLLKNYSYNEIHNRRVALGITCVQCTPVQLEI 137

  Fly    93 LRRAGAMPVSSRRCGMITRREAERLCKSFLGDNTPPRLPDDFAFNVQHKCAWGCRGSFLPSRYNS 157
            ||||||||:|||||||||:||||||||||||::.||:||::|||:|.|:||||.||||:|:||||
  Rat   138 LRRAGAMPISSRRCGMITKREAERLCKSFLGEHKPPKLPENFAFDVVHECAWGSRGSFIPARYNS 202

  Fly   158 SRAKCIKCSYCGMFFSPNKFIFHSHRITTNDRYVQPDAANFNSWRRHMSLSGNDYDEKIIHAWED 222
            ||||||||.||.|:|||||||||||| |.:.:|.|||||||||||||:.||.....:::.|||||
  Rat   203 SRAKCIKCGYCSMYFSPNKFIFHSHR-TPDAKYTQPDAANFNSWRRHLKLSDKSATDELSHAWED 266

  Fly   223 VKAMFNGGTRKR----------------------------------------------------- 234
            ||||||||||||                                                     
  Rat   267 VKAMFNGGTRKRTFSLQGGGGGGANSGSGGAGKGGAGGGGGPGCGSEMAPGPPPHKSLRCGEDEA 331

  Fly   235 ----------------LVGSSINPRSPGSPTQSTAV---------SSGVG----------SSSCG 264
                            |..::..|..||.|..|..|         |.|.|          ....|
  Rat   332 SGPPGPPPPHPQRALGLAAAANGPAGPGGPGGSAGVRSYPVIPVPSKGFGLLQKLPPPLFPHPYG 396

  Fly   265 SPTSF----ERD-----TNEVDGKSGS-------------------------------------- 282
            .||:|    ::|     ..|..|..|:                                      
  Rat   397 FPTAFGLCPKKDDPVLVAGEPKGGPGTGSGGGAGTAAGAGGPGAGHLPPGAGPGPGGGTMFWGHQ 461

  Fly   283 --------------------------------SLPQRSQIDSQYNYGTVAAAAAVVGVTAVAAAT 315
                                            |||......:|.....||||.|.....|.|||.
  Rat   462 PSGAAKDAAAVAAAAAAATVYPTFPMFWPAAGSLPVPPYPAAQSQAKAVAAAVAAAAAAAAAAAG 526

  Fly   316 VGVPFNLHGSTVLSPLH--SLRNER----DLSIMPISRNFVVDYMWQQKDQHYQQPYARKIPSGD 374
            .|.|.:|.|:   .|..  ||..|.    .||..|:..                          |
  Rat   527 GGGPESLDGA---EPAKEGSLGTEERCPSALSRGPLDE--------------------------D 562

  Fly   375 NSDSSLDFDSWVKPDSNNPI---PNANSVRTSDNCSFN--IKN-ESHSSIYGIIKNHKLSG---- 429
            .:|.:|       |.|..|:   |...:.::|...:|.  :|: ||.:.:||..:....||    
  Rat   563 GADEAL-------PPSLAPLAPPPPPPARKSSYVSAFRPVVKDAESIAKLYGSAREAYGSGPARG 620

  Fly   430 -VPNSGLNLSDYNIPSILNCSAFKPVVASTAIVSTSLYTRSNESTRTDCNNPAQSTRTTTVLTHN 493
             ||.:|.. ..|..|..|:..:.....||..:.:........||.|......||..      |..
  Rat   621 PVPGTGTG-GGYVSPDFLSEGSSSYHSASPDVDTADEPEVDVESNRFPDEEGAQED------TEP 678

  Fly   494 SISASSHQIVGHKTFSPILGKIHSNPEKNRIVSVFASSSTGNADDNDDD---------------- 542
            |:.::.....|.:...|              .||.:|.:.|..|..|.|                
  Rat   679 SVPSTGGGPDGDQPAGP--------------PSVTSSGADGPTDSADGDSPRPRRRLGPPPAIRS 729

  Fly   543 -------DEVV-DIETTEDEGKFTV---------------------QHADS--------PKTQYD 570
                   |:|| ..|.:...|.:.:                     :|..|        |...|.
  Rat   730 AFGDLVADDVVRRTERSPPNGGYELREPCGPLGGPAAAKVYVPERDEHVKSAAAAAALGPAASYL 794

  Fly   571 AISGSDSPSRSPSTSTNID-------------VEQDVDVDIITTDTEDQLELSV-GRYSTENTSH 621
            ....:..|.:..:.||..|             |.|....:  |...||.|.|.| |....|....
  Rat   795 CTPETHEPDKEDNHSTTADDLETRKSFSDQRSVSQPSPAN--TDRGEDGLTLDVTGTQLVEKDIE 857

  Fly   622 SLSFFQAEKIQISDLSPNTKTSSGDNETNTLKDAKGINGNLQILARRKRNKLQKDRCLSKRTVSK 686
            :|:..:.:|:.:..:....|.   :.|..:|||      |.|...:|:         |:.|  .:
  Rat   858 NLAREELQKLLLEQMELRKKL---EREFQSLKD------NFQDQMKRE---------LAYR--EE 902

  Fly   687 CVSDKSLIKGLAANELSSSLQ----IQQ 710
            .|....:::....|||....:    |||
  Rat   903 MVQQLQIVRDTLCNELDQERKARYAIQQ 930

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fussNP_001162829.1 Ski_Sno 25..123 CDD:280577 81/95 (85%)
c-SKI_SMAD_bind 135..228 CDD:198114 67/93 (72%)
Skor1XP_006226487.2 Ski_Sno 75..168 CDD:280577 81/93 (87%)
c-SKI_SMAD_bind 180..272 CDD:198114 67/93 (72%)
RILP-like <843..941 CDD:304877 23/109 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C3ZR
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T617485
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10005
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
43.960

Return to query results.
Submit another query.