DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fuss and Skor1

Sequence 1:NP_001162829.1 Gene:fuss FlyBaseID:FBgn0039932 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_766034.2 Gene:Skor1 MGIID:2443473 Length:964 Species:Mus musculus

Alignment Length:977 Identity:284/978 (29%)
Similarity:364/978 (37%) Gaps:374/978 (38%)


  Fly    28 RSNHVSSVLLYGVQIVSLHIEGQERLCLAQISNTLLKQFSYNEIHNRRVALGITCVQCTPVQLEI 92
            :.|.|....||||.||||.|:||||||||||||||||.:||||||||||||||||||||||||||
Mouse    73 KPNQVGETSLYGVPIVSLVIDGQERLCLAQISNTLLKNYSYNEIHNRRVALGITCVQCTPVQLEI 137

  Fly    93 LRRAGAMPVSSRRCGMITRREAERLCKSFLGDNTPPRLPDDFAFNVQHKCAWGCRGSFLPSRYNS 157
            ||||||||:|||||||||:||||||||||||::.||:||::|||:|.|:||||.||||:|:||||
Mouse   138 LRRAGAMPISSRRCGMITKREAERLCKSFLGEHKPPKLPENFAFDVVHECAWGSRGSFIPARYNS 202

  Fly   158 SRAKCIKCSYCGMFFSPNKFIFHSHRITTNDRYVQPDAANFNSWRRHMSLSGNDYDEKIIHAWED 222
            ||||||||.||.|:|||||||||||| |.:.:|.|||||||||||||:.||.....:::.|||||
Mouse   203 SRAKCIKCGYCSMYFSPNKFIFHSHR-TPDAKYTQPDAANFNSWRRHLKLSDKSATDELSHAWED 266

  Fly   223 VKAMFNGGTRKR----------------------------------------------------- 234
            ||||||||||||                                                     
Mouse   267 VKAMFNGGTRKRTFSLQGGGGGGANSGSGGAGKGGAGGGGGPGCGSEMAPGPPPHKSLRCGEDEA 331

  Fly   235 ----------------LVGSSINPRSPGSPTQSTAVSS--------------------------- 256
                            |..::..|..||.|..|..|.|                           
Mouse   332 AGPPGPPPPHPQRALGLAAAASGPAGPGGPGGSAGVRSYPVIPVPSKGFGLLQKLPPPLFPHPYG 396

  Fly   257 -----------------------GVGSSSCG---------------------------------S 265
                                   |.|:.|.|                                 .
Mouse   397 FPTAFGLCPKKDDPVLVAGEPKGGPGTGSSGGAGTAAGAGGPGAGHLPPGAGPGPGGGTMFWGHQ 461

  Fly   266 PTSFERDTNEVDGKSGS---------------SLPQRSQIDSQYNYGTVAAAAAVVGVTAVAAAT 315
            |:...:|...|...:.:               |||......:|.....||||.|.....|.|||.
Mouse   462 PSGAAKDAAAVAAAAAAATVYPTFPMFWPAAGSLPVPPYPAAQSQAKAVAAAVAAAAAAAAAAAG 526

  Fly   316 VGVPFNLHGSTVLSPLH--SLRNER----DLSIMPISRNFVVDYMWQQKDQHYQQPYARKIPSGD 374
            .|.|.:|.|:   .|..  ||..|.    .||..|:..                          |
Mouse   527 GGGPESLDGA---EPAKEGSLGTEERCPSALSRGPLDE--------------------------D 562

  Fly   375 NSDSSLDFDSWVKPDSNNPIPNANSVRTSDNCSFNIKNESHSSIYGIIKNHKLSGVPNSGLNLSD 439
            .:|.:|       |.|..|:|..                                 |......|.
Mouse   563 GADEAL-------PPSLGPLPPP---------------------------------PPPPARKSS 587

  Fly   440 YNIPSILNCSAFKPVVASTAIVSTSLYTRSNESTRT-DCNNPAQSTRTTTVLTHNSISASSHQIV 503
            |       .|||:|||.....:: .||..:.|:..: ....|...|.|                 
Mouse   588 Y-------VSAFRPVVKDAESIA-KLYGSAREAYGSGPARGPVPGTGT----------------- 627

  Fly   504 GHKTFSPILGKIHSNPEKNRIVSVFASSSTGNADDNDDDDE-VVDIETT---EDEGKFTVQHADS 564
                     |..:.:|:   .:|..:||....:.|.|..|| .||:|:.   ::||.     .|.
Mouse   628 ---------GGGYVSPD---FLSEGSSSYHSASPDVDTADEPEVDVESNRFPDEEGA-----QDD 675

  Fly   565 PKTQYDAISG---SDSPSRSPS-TSTNIDVEQD---------------------VDVDIITTDTE 604
            .:.:..:..|   .|.|:..|| ||:..|...|                     ...|::..|..
Mouse   676 TEPRAPSTGGGPDGDQPAGPPSVTSSGADGPTDSADGDSPRPRRRLGPPPAIRSAFGDLVADDVV 740

  Fly   605 DQLELS--------------VGR------YSTENTSH------------SLSFFQAEKIQISDLS 637
            .:.|.|              :|.      |:.|...|            :.|:....:....|..
Mouse   741 RRTERSPPSGGYELREPCGPLGGPGAAKVYAPERDEHVKSTAVAAALGPAASYLCTPETHEPDKE 805

  Fly   638 PNTKTSSGDNET-NTLKDAKGINGNLQILARRKRNKLQKDRCLSKRTVSKCVSDKSLIKGLAANE 701
            .|..|::.|.|| .:..|.:.::........|..:.|..| ....:.|.|.      |:.||..|
Mouse   806 DNHSTTADDLETRKSFSDQRSVSQPSPANTDRGEDGLTLD-VTGTQLVEKD------IENLAREE 863

  Fly   702 LSSSLQIQQHVAFPVFLKSQLHSLRP-----------------QQAQQVVSLTTNSVAESNKWSY 749
            |...|..|..:...  |:.:..||:.                 ||.|.|.....|.:.:..|..|
Mouse   864 LQKLLLEQMELRKK--LEREFQSLKDNFQDQMKRELAYREEMVQQLQIVRDTLCNELDQERKARY 926

  Fly   750 PV 751
            .:
Mouse   927 AI 928

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fussNP_001162829.1 Ski_Sno 25..123 CDD:280577 81/95 (85%)
c-SKI_SMAD_bind 135..228 CDD:198114 67/93 (72%)
Skor1NP_766034.2 Ski_Sno 75..168 CDD:280577 81/93 (87%)
c-SKI_SMAD_bind 180..272 CDD:198114 67/93 (72%)
RILP-like <843..941 CDD:304877 20/96 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C3ZR
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10005
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5040
TreeFam 1 0.960
43.990

Return to query results.
Submit another query.