DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fuss and daf-5

Sequence 1:NP_001162829.1 Gene:fuss FlyBaseID:FBgn0039932 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_496941.1 Gene:daf-5 WormBaseID:WBGene00000901 Length:627 Species:Caenorhabditis elegans

Alignment Length:268 Identity:51/269 (19%)
Similarity:93/269 (35%) Gaps:74/269 (28%)


  Fly    35 VLLYGVQIVSLHIEGQERLCLAQISNTLLK-----QFSY-NEIHNRRVALGITCVQCTPVQLEIL 93
            :.|.||::.:|.|:|:..|.:..:.:.|.|     |.|: |.:..:.|.:.:    .:|.|..  
 Worm    78 IWLLGVRVPALSIDGEPHLPIEILDDMLTKKDKKDQMSFQNLLRYKNVYIRM----ASPSQFR-- 136

  Fly    94 RRAGAMPVSSRRC--------GMITRREAERL--------------------------------- 117
                |:...|:.|        .:::|.:.||:                                 
 Worm   137 ----AVMEKSKECENLNITSLSLMSRSDIERIMGELRLESMLTLAEHDNWDISDRVHVVHVNFID 197

  Fly   118 -CKSFLGDNTPPRLPDDFAFNVQHKCAWGCRGSFLPSRYNSSRAKCIKCSYCGMFFSPNKFIFHS 181
             |..:|..       ||...:|...   |..|.:..:|.|   .:||:|.:|...|:|..||.|.
 Worm   198 YCSEWLES-------DDLEEDVMQS---GTHGYWYKNRRN---MRCIECQHCEGKFTPTDFIMHH 249

  Fly   182 HRITTNDRYVQPDAANFNSWRRHMSLSGNDYDEKIIHAWEDVKAMFNGGTRKRLVGSSINPRSPG 246
            |.......:|.....:| .|.|.:.:.  |...:.:.||.......:...::....::.:...|.
 Worm   250 HYPIKPSGFVHTGCNSF-QWIRLIEVF--DKSNENLEAWNKFVLNSHRAGKREYDEAAPHQAPPK 311

  Fly   247 SPTQSTAV 254
            .|...|.|
 Worm   312 RPAMETPV 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fussNP_001162829.1 Ski_Sno 25..123 CDD:280577 23/136 (17%)
c-SKI_SMAD_bind 135..228 CDD:198114 22/93 (24%)
daf-5NP_496941.1 c-SKI_SMAD_bind <230..283 CDD:298254 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10005
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.