DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fuss and skor1

Sequence 1:NP_001162829.1 Gene:fuss FlyBaseID:FBgn0039932 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_012814921.1 Gene:skor1 XenbaseID:XB-GENE-877133 Length:742 Species:Xenopus tropicalis

Alignment Length:781 Identity:268/782 (34%)
Similarity:369/782 (47%) Gaps:176/782 (23%)


  Fly    13 SVAHFDRMENCQT---SQRSNHVSSVLLYGVQIVSLHIEGQERLCLAQISNTLLKQFSYNEIHNR 74
            |..|....|| ||   |.:.|.|....||||.||||.|:||||||||||||||||.:||||||||
 Frog    16 SKQHQSPQEN-QTFTGSLKPNQVGETCLYGVPIVSLVIDGQERLCLAQISNTLLKSYSYNEIHNR 79

  Fly    75 RVALGITCVQCTPVQLEILRRAGAMPVSSRRCGMITRREAERLCKSFLGDNTPPRLPDDFAFNVQ 139
            ||||||||||||||||||||||||||:|||||||||:||||||||||||::.||:||::|||:|.
 Frog    80 RVALGITCVQCTPVQLEILRRAGAMPISSRRCGMITKREAERLCKSFLGEHRPPKLPENFAFDVA 144

  Fly   140 HKCAWGCRGSFLPSRYNSSRAKCIKCSYCGMFFSPNKFIFHSHRITTNDRYVQPDAANFNSWRRH 204
            |:|||||||||:|:||||||||||||:|||::|||||||||||| |.:.:|.|||||||||||||
 Frog   145 HECAWGCRGSFIPARYNSSRAKCIKCAYCGLYFSPNKFIFHSHR-TPDSKYTQPDAANFNSWRRH 208

  Fly   205 MSLSGNDYDEKIIHAWEDVKAMFNGGTRKRLVGS---------------SINPRSPGSPTQSTAV 254
            :.|:.....:.:.|:|||||||||||||||...|               .:.|..|..|.::...
 Frog   209 LRLNDTTPSDDLSHSWEDVKAMFNGGTRKRAFPSPASSSSSSSSARRHLELAPPPPPPPAKALRG 273

  Fly   255 SSGVGSSSCGSPTSF------ERDTNEVDGKSGSSL-PQRSQIDSQYNY--------------GT 298
            .|....|...:..||      .:..:.|..|.|..| |     ...|.:              |.
 Frog   274 PSAEEESGATAARSFPLIPVPSKGFSGVLHKMGPPLFP-----PPPYGFPAFGLCAKKDDGGLGD 333

  Fly   299 VAAAAAVVGV---TAVAAA-TVGVPFNLH-----GSTVLSPLHSLRNERDLSIMPISRNFVVDYM 354
            ...||.:.||   ||.|:. :|..||.:.     |:..:.|...|..::.:.    .::.||.  
 Frog   334 AGKAAGLPGVFWPTAPASKDSVYPPFPVFWPAAAGALPVPPYTGLTQQQQVP----GKSAVVG-- 392

  Fly   355 WQQKDQHYQQPYARKIPSGDNSDSSLDFDSWVKPDSNNPIPNANSVRTSDN-------------- 405
                     :|...: |||:.::.                |.....|:.|.              
 Frog   393 ---------EPEEAE-PSGETAEE----------------PTREEERSGDEGRQPGEPLTPRKLR 431

  Fly   406 --CSFN--IK-NESHSSIYGIIKNHKLSGVPNSGLNLSDYNIPSIL-NCSAFK-----PVVASTA 459
              .:|.  :| .||.:.:||   :.:|.|...:    :.|:.|.:| :.|:::     |..|...
 Frog   432 YISAFRPVVKAAESLAKLYG---SRELYGAARA----AGYSSPDLLSDTSSYRSASPSPDTADEP 489

  Fly   460 IVST-SLYTRSNESTRTDCNNPAQSTRTTTVLTHN---SISASSHQIVGHKTFSPILGKIHSNPE 520
            .|.. |......||.:.....|..|:..::..:..   |...|...:.|::.::..:..:....:
 Frog   490 EVDVESGRFPEEESAQLGSLGPGASSSISSPGSERREPSPGGSPASVAGYEVYAKQMTDLPHLMK 554

  Fly   521 KNRIVSVFASSSTGNADDNDDDDEVVDIETTEDEGKFTVQHADSPKTQYDAIS--GSDSPSRSPS 583
            .|......:||...|.|.|:.|.|  |..:|.:|       .||.|...|..|  ...||..:..
 Frog   555 GNSSHQGVSSSYLCNLDPNEQDSE--DSHSTAEE-------LDSRKAFQDPRSHLSHTSPLHTDR 610

  Fly   584 TSTNIDVEQDVDVDIITTDTEDQLELSVGRYSTENTSHSLSFFQAEKIQISDLSPNTKTSSGDNE 648
            .      |:|..:|:            .|....|....:::..:.:|:.:..:....|.   :.|
 Frog   611 G------EEDSPIDV------------TGTQFVEKDIENMAKDELQKLLVEQMDLRKKL---ERE 654

  Fly   649 TNTLKDAKGINGNLQILARRKRNKLQKDRCLSKRTVSKCVSDKSLIKGLAANELSSSLQ----IQ 709
            ..:|||      |.|...:|:         |:.|  .:.|....:::....|||....:    ||
 Frog   655 FQSLKD------NFQDQMKRE---------LAYR--EEMVQQLQIVRDTLCNELDQERKARYAIQ 702

  Fly   710 Q 710
            |
 Frog   703 Q 703

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fussNP_001162829.1 Ski_Sno 25..123 CDD:280577 83/101 (82%)
c-SKI_SMAD_bind 135..228 CDD:198114 66/93 (71%)
skor1XP_012814921.1 Ski_Sno 35..128 CDD:280577 81/93 (87%)
c-SKI_SMAD_bind 141..231 CDD:285935 64/91 (70%)
RILP-like <630..719 CDD:304877 18/95 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C3ZR
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006061
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.