DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fuss and skor1a

Sequence 1:NP_001162829.1 Gene:fuss FlyBaseID:FBgn0039932 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001124124.1 Gene:skor1a ZFINID:ZDB-GENE-080722-5 Length:751 Species:Danio rerio

Alignment Length:799 Identity:274/800 (34%)
Similarity:378/800 (47%) Gaps:187/800 (23%)


  Fly    25 TSQRSNHVSSVLLYGVQIVSLHIEGQERLCLAQISNTLLKQFSYNEIHNRRVALGITCVQCTPVQ 89
            :|.:.|.||...||||.||||.|:||||||||||||||||.:|||||||||||||||||||||||
Zfish    31 SSMKPNQVSETALYGVPIVSLVIDGQERLCLAQISNTLLKNYSYNEIHNRRVALGITCVQCTPVQ 95

  Fly    90 LEILRRAGAMPVSSRRCGMITRREAERLCKSFLGDNTPPRLPDDFAFNVQHKCAWGCRGSFLPSR 154
            |||||||||||:|||||||||:||||||||||||.:.||:||::|||:|.|:|||||||:|:|:|
Zfish    96 LEILRRAGAMPISSRRCGMITKREAERLCKSFLGAHNPPKLPENFAFDVSHECAWGCRGNFIPAR 160

  Fly   155 YNSSRAKCIKCSYCGMFFSPNKFIFHSHRITTNDRYVQPDAANFNSWRRHMSLSGNDYDEKIIHA 219
            |||||||||||:||.|:|||||||||||| |...:|.|||||||||||||:.|:.....:.:.||
Zfish   161 YNSSRAKCIKCTYCNMYFSPNKFIFHSHR-TPESKYTQPDAANFNSWRRHLKLTDKSLADDLCHA 224

  Fly   220 WEDVKAMFNGGTRKRL-------VGSSINPRSPGSPTQSTAVSSGVGSSSCGSPTSFERDTNEVD 277
            |||||||||||:|||.       :.|.:.|:|.|:.||:|:             :.....|...|
Zfish   225 WEDVKAMFNGGSRKRAMPGSGSEMSSHLKPQSSGNITQTTS-------------SDIPHKTLRCD 276

  Fly   278 GKSGSSLPQRSQIDSQYNYGTVAAAAAVVGVTAVAAATVGVPFNLHGSTVLSPLHSLRNERDLSI 342
            ...|:    .|..:|..||..:...:...|:..      .:|..:.......|...|..::|..:
Zfish   277 DDRGN----LSLSNSVRNYPVIPVPSKSFGMLQ------KIPPPIFPHPYSFPAFGLCQKKDDGV 331

  Fly   343 MPISRNFVVDYMWQ-QKDQHYQQ-----PYARKIP-------------SGDNSDSSLDFDSWVKP 388
            ...::..|....|. .||..|..     |.|..:|             .|..:::.:   |..:.
Zfish   332 GEQNKTNVPSVFWPGAKDGIYPSFPMFWPTAGSLPLSSYQPKPHADLLGGRQTEAEI---SESER 393

  Fly   389 DSNNPIPNANSVRTSDNCSF--NIKN-------ESHSSIYGIIKNHKLSGVPNSGLNLSDYNIPS 444
            ..|.|   .:|:..|:.||.  :::|       |:.||          .|.|::...||      
Zfish   394 GGNTP---RDSLFDSERCSSSQSLRNDEDKSGDEARSS----------EGQPSTPRKLS------ 439

  Fly   445 ILNCSAFKPVVASTAIVSTSLYTRSNESTRTDCNNPAQSTRTTTVLTHNSISASSHQIVGHKTFS 509
              ..|||:|||.....:: .||.          |..|.|......|:.:.:|.||    .:::.|
Zfish   440 --YISAFRPVVKDAESIA-KLYG----------NRDAYSGAHPGHLSPDFVSESS----SYRSAS 487

  Fly   510 PILGKIHSNPEKNRIVSVFASSSTGNADDNDDDDEVVDIET-----TEDEGKFTVQHADSPKTQY 569
            |.                        ||..::.|  ||:||     .|:..:.:|....||..: 
Zfish   488 PC------------------------ADSGEEPD--VDVETHRIPDDEESIQLSVDDRQSPVRE- 525

  Fly   570 DAISGSDSPSRSP---------STSTNIDVEQDVDV----DIITTDTEDQLELSVGRYSTENTSH 621
                  |:|:..|         |.|.:.|.:|:..|    |.|..|.          ||.|....
Zfish   526 ------DTPTPQPDDDHQTVTFSDSGSPDHKQNKQVAKKSDAIAYDV----------YSHEKDGA 574

  Fly   622 SL-SFFQAEKIQISDLSPNTKTSSGDNET-NTLKDAKGINGNLQILARRKRNKLQKDRCLSKRTV 684
            || :.......::|..:.:|..|...|.| :..:..|..:..:::   .:.|.:  |..|  |:.
Zfish   575 SLQNTLSCSASKLSRCAQDTNDSHISNSTDDECESQKSCSDQIRV---SRENSI--DAAL--RST 632

  Fly   685 SKCVSDKSLIKGLAANELSSSLQIQQHVAFPVFLKSQLHSLRP-----------------QQAQQ 732
            ....:.:..|:.:|..||..  |:.:.|.....|:.:..||:.                 ||.|.
Zfish   633 DNRFNFEKDIENMAKEELQK--QLLEQVELRKKLEREFQSLKDNFQDQMKRELSYREEMVQQLQI 695

  Fly   733 VVSLTTNSVAESNKWSYPV 751
            |.....|.:.:..|..|.:
Zfish   696 VRDTLCNELDQERKARYAI 714

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fussNP_001162829.1 Ski_Sno 25..123 CDD:280577 83/98 (85%)
c-SKI_SMAD_bind 135..228 CDD:198114 66/93 (71%)
skor1aNP_001124124.1 Ski_Sno 36..129 CDD:280577 82/93 (88%)
c-SKI_SMAD_bind 142..232 CDD:285935 64/91 (70%)
RILP-like <648..727 CDD:304877 14/70 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C3ZR
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10005
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.