DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment pho and Klf10

DIOPT Version :9

Sequence 1:	NP_524630.1	Gene:	pho / 43819	FlyBaseID:	FBgn0002521	Length:	520	Species:	Drosophila melanogaster
Sequence 2:	NP_112397.1	Gene:	Klf10 / 81813	RGDID:	621652	Length:	480	Species:	Rattus norvegicus

Alignment Length:	104	Identity:	43/104 - (41%)
Similarity:	61/104 - (58%)	Gaps:	9/104 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   370 DSSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTH 434
            |||.:|.|:.:|       ..|||.:.:||.||.|...|||||||.|:::||.:||:....|..|
  Rat   362 DSSRVRSHICSH-------PGCGKTYFKSSHLKAHVRTHTGEKPFSCSWKGCERRFARSDELSRH 419

  Fly   435 VRIHTGDRPFVCPFDACNKKFAQSTNLKSHILTHAKAKR 473
            .|.|||::.|.||.  |:::|.:|.:|..|...|..||:
  Rat   420 RRTHTGEKKFACPM--CDRRFMRSDHLTKHARRHLSAKK 456

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
pho	NP_524630.1	Transpos_assoc	<342..382	CDD:290671	5/11 (45%)
		C2H2 Zn finger	359..381	CDD:275368	5/10 (50%)
		COG5048	<386..515	CDD:227381	37/88 (42%)
		zf-C2H2	386..408	CDD:278523	8/21 (38%)
		C2H2 Zn finger	388..408	CDD:275368	8/19 (42%)
		zf-H2C2_2	401..426	CDD:290200	14/24 (58%)
		C2H2 Zn finger	416..438	CDD:275368	8/21 (38%)
		zf-H2C2_2	430..457	CDD:290200	11/26 (42%)
		C2H2 Zn finger	446..468	CDD:275368	7/21 (33%)
Klf10	NP_112397.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..32
		KLF10_N	33..369	CDD:409241	4/6 (67%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	64..83
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	97..146
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	202..222
		zf-C2H2	369..393	CDD:395048	10/30 (33%)
		C2H2 Zn finger	374..393	CDD:275368	8/18 (44%)
		zf-H2C2_2	385..412	CDD:404364	15/26 (58%)
		C2H2 Zn finger	401..423	CDD:275368	8/21 (38%)
		zf-C2H2	429..451	CDD:395048	8/23 (35%)
		C2H2 Zn finger	431..451	CDD:275368	7/21 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910