DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pho and Nacc2

DIOPT Version :9

Sequence 1:NP_524630.1 Gene:pho / 43819 FlyBaseID:FBgn0002521 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001032175.1 Gene:Nacc2 / 67991 MGIID:1915241 Length:586 Species:Mus musculus


Alignment Length:223 Identity:46/223 - (20%)
Similarity:70/223 - (31%) Gaps:78/223 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 GASDLLKGKEEFGIDGFTSQQNKEYQKMESKFTNAQTLEMPHPISSVQIMDHLIKERGNLSQENN 248
            |||.|..      .|..||..|:|.::.:..:..         :...|.....||..||.:    
Mouse   248 GASSLPT------TDSPTSYHNEEDEEDDEAYDT---------MVEEQYGQMYIKATGNYA---- 293

  Fly   249 ISERILSKTTLSFEEPILLPDSSSIELVNETAAMTINNHRTLSNHTGNTGDLHALPSSVPFRIGL 313
            :.|:         .||:.| :|.|..|:..                    ||.|||:|:..:||.
Mouse   294 VQEK---------PEPVPL-ESRSCVLIRR--------------------DLVALPASLISQIGY 328

  Fly   314 H-------EGQVNDCLSTISQSTHQDNTDSTGCGEMNLSEVTVSYTNDKKIACPHKGCNKHFRDS 371
            .       ||...:.|..::           |.|        |..|..:.:.|......||   .
Mouse   329 RCHPKLYSEGDPGEKLELVA-----------GSG--------VYITRGQLMNCHLCAGVKH---K 371

  Fly   372 SAMRKHLHTHGPRVHVCAECGKAFVESS 399
            ..:|:.|.|...|..:...||.....|:
Mouse   372 VLLRRLLATFFDRNTLANSCGTGIRSST 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phoNP_524630.1 Transpos_assoc <342..382 CDD:290671 8/39 (21%)
C2H2 Zn finger 359..381 CDD:275368 5/21 (24%)
COG5048 <386..515 CDD:227381 3/14 (21%)
zf-C2H2 386..408 CDD:278523 3/14 (21%)
C2H2 Zn finger 388..408 CDD:275368 3/12 (25%)
zf-H2C2_2 401..426 CDD:290200
C2H2 Zn finger 416..438 CDD:275368
zf-H2C2_2 430..457 CDD:290200
C2H2 Zn finger 446..468 CDD:275368
Nacc2NP_001032175.1 BTB_POZ_BTBD14A_NAC2 1..131 CDD:349598
Prog_receptor <139..241 CDD:366948
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..196
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..272 9/29 (31%)
BEN 371..448 CDD:214981 7/29 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.