DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pho and klf7b

DIOPT Version :9

Sequence 1:NP_524630.1 Gene:pho / 43819 FlyBaseID:FBgn0002521 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001038231.1 Gene:klf7b / 553082 ZFINID:ZDB-GENE-041014-171 Length:295 Species:Danio rerio


Alignment Length:231 Identity:70/231 - (30%)
Similarity:99/231 - (42%) Gaps:45/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 EEPILLPDSSSIELVNETAAMTINNHRTLSNHTG--NTGDLHAL----PSSVPFRIGLHEGQVND 320
            :||...|...|:.....|.|.|.:....|...:|  |...|:|:    |.|.| .:|.|..:...
Zfish    85 DEPSPPPLLVSLPKTLHTPANTKSTDAGLKEASGGVNPAQLNAVTSLTPPSSP-ELGRHLVKPTQ 148

  Fly   321 CLSTISQSTHQDNTDSTGCGEMNLSEVT--VSYTNDKKIAC------PHKGCNKHFRDSSAMRKH 377
            .|:            :|..|.:.|..|.  |.....|.:|.      |::|      ..|.....
Zfish   149 TLT------------ATADGTLTLKLVAKKVGLGAAKLVATHSIPSPPNRG------TQSDGEGG 195

  Fly   378 LHTHG--------PRVHVCA--ECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLR 432
            |.|.|        .|||.|.  .|.|.:.:||.||.||..||||||::|::|||..||:....|.
Zfish   196 LGTVGGGDIPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELT 260

  Fly   433 THVRIHTGDRPFVCPFDACNKKFAQSTNLKSHILTH 468
            .|.|.|||.:||.|  :.|::.|::|.:|..|:..|
Zfish   261 RHYRKHTGAKPFKC--NHCDRCFSRSDHLALHMKRH 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phoNP_524630.1 Transpos_assoc <342..382 CDD:290671 10/47 (21%)
C2H2 Zn finger 359..381 CDD:275368 4/27 (15%)
COG5048 <386..515 CDD:227381 37/85 (44%)
zf-C2H2 386..408 CDD:278523 10/23 (43%)
C2H2 Zn finger 388..408 CDD:275368 9/21 (43%)
zf-H2C2_2 401..426 CDD:290200 15/24 (63%)
C2H2 Zn finger 416..438 CDD:275368 9/21 (43%)
zf-H2C2_2 430..457 CDD:290200 11/26 (42%)
C2H2 Zn finger 446..468 CDD:275368 6/21 (29%)
klf7bNP_001038231.1 COG5048 205..>277 CDD:227381 33/73 (45%)
C2H2 Zn finger 214..236 CDD:275368 9/21 (43%)
zf-H2C2_2 228..>244 CDD:290200 10/15 (67%)
C2H2 Zn finger 244..266 CDD:275368 9/21 (43%)
zf-H2C2_2 258..283 CDD:290200 11/26 (42%)
C2H2 Zn finger 274..294 CDD:275368 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.