DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment pho and klhl12

DIOPT Version :9

Sequence 1:	NP_524630.1	Gene:	pho / 43819	FlyBaseID:	FBgn0002521	Length:	520	Species:	Drosophila melanogaster
Sequence 2:	NP_001007329.1	Gene:	klhl12 / 492362	ZFINID:	ZDB-GENE-041114-205	Length:	564	Species:	Danio rerio

Alignment Length:	133	Identity:	30/133 - (22%)
Similarity:	49/133 - (36%)	Gaps:	44/133 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly   183 VGASDLLKGKEEFGIDGFTSQQNKEYQKMESKFTNAQTLEMPHPISSVQIMDHLIKERGNLSQEN 247
            :||.::|     ..|.||.|||:                    ||..|:..|...:|...|.
Zfish   273 LGAKEVL-----LVIGGFGSQQS--------------------PIDIVEKYDPKTREWSFLP--- 309

  Fly   248 NISERILSKTTLSFEEPILLPDS-------SSIELVNETA--------AMTINNHRTLSNHTGNT 297
            ||:.:.....|::..:.:.:...       ||:|.::.||        ..|:|..|.|:..| ..
Zfish   310 NIARKRRYVATVALNDRVYVIGGYDGRSRLSSVECLDYTADEDGVWYSVATMNVRRGLAGAT-TL 373

  Fly   298 GDL 300
            ||:
Zfish   374 GDM 376

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
pho	NP_524630.1	Transpos_assoc	<342..382	CDD:290671
		C2H2 Zn finger	359..381	CDD:275368
		COG5048	<386..515	CDD:227381
		zf-C2H2	386..408	CDD:278523
		C2H2 Zn finger	388..408	CDD:275368
		zf-H2C2_2	401..426	CDD:290200
		C2H2 Zn finger	416..438	CDD:275368
		zf-H2C2_2	430..457	CDD:290200
		C2H2 Zn finger	446..468	CDD:275368
klhl12	NP_001007329.1	BTB	19..122	CDD:279045
		PHA03098	20..501	CDD:222983	30/133 (23%)
		BACK	131..232	CDD:285009
		Kelch	278..325	CDD:128874	16/74 (22%)
		Kelch 1	278..325		16/74 (22%)
		KELCH repeat	315..361	CDD:276965	6/45 (13%)
		Kelch	326..375	CDD:128874	10/49 (20%)
		Kelch 2	327..375		10/48 (21%)
		KELCH repeat	365..408	CDD:276965	5/13 (38%)
		Kelch 3	376..422		0/1 (0%)
		Kelch	377..422	CDD:128874	30/133 (23%)
		KELCH repeat	412..455	CDD:276965
		Kelch	423..469	CDD:128874
		Kelch 4	423..469
		KELCH repeat	459..503	CDD:276965
		Kelch	470..516	CDD:128874
		Kelch 5	471..516
		KELCH repeat	506..551	CDD:276965
		Kelch	517..561	CDD:128874
		Kelch 6	518..563
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910