DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pho and NACC2

DIOPT Version :9

Sequence 1:NP_524630.1 Gene:pho / 43819 FlyBaseID:FBgn0002521 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_653254.1 Gene:NACC2 / 138151 HGNCID:23846 Length:587 Species:Homo sapiens


Alignment Length:239 Identity:49/239 - (20%)
Similarity:77/239 - (32%) Gaps:81/239 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 GISDDEY-SGSDQIVGASDLLKGKEEFGIDGFTSQQNKEYQKMESKFTNAQTLEMPHPISSVQIM 233
            ||....| .|.....|||.|..      .|..||..|:|.::.:..:                  
Human   235 GIQQMPYPQGERTSPGASSLPT------TDSPTSYHNEEDEEDDEAY------------------ 275

  Fly   234 DHLIKER-GNLSQENNISERILSKTTLSFEEPILLPDSSSIELVNETAAMTINNHRTLSNHTGNT 297
            |.:::|: |.:..:.:.|..:..|     .||:.| :|.|..|:..                   
Human   276 DTMVEEQYGQMYIKASGSYAVQEK-----PEPVPL-ESRSCVLIRR------------------- 315

  Fly   298 GDLHALPSSVPFRIGLH-------EGQVNDCLSTISQSTHQDNTDSTGCGEMNLSEVTVSYTNDK 355
             ||.|||:|:..:||..       ||...:.|..::           |.|        |..|..:
Human   316 -DLVALPASLISQIGYRCHPKLYSEGDPGEKLELVA-----------GSG--------VYITRGQ 360

  Fly   356 KIACPHKGCNKHFRDSSAMRKHLHTHGPRVHVCAECGKAFVESS 399
            .:.|......||   ...:|:.|.|...|..:...||.....|:
Human   361 LMNCHLCAGVKH---KVLLRRLLATFFDRNTLANSCGTGIRSST 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phoNP_524630.1 Transpos_assoc <342..382 CDD:290671 8/39 (21%)
C2H2 Zn finger 359..381 CDD:275368 5/21 (24%)
COG5048 <386..515 CDD:227381 3/14 (21%)
zf-C2H2 386..408 CDD:278523 3/14 (21%)
C2H2 Zn finger 388..408 CDD:275368 3/12 (25%)
zf-H2C2_2 401..426 CDD:290200
C2H2 Zn finger 416..438 CDD:275368
zf-H2C2_2 430..457 CDD:290200
C2H2 Zn finger 446..468 CDD:275368
NACC2NP_653254.1 BTB 20..120 CDD:279045
BTB 31..114 CDD:197585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..272 11/37 (30%)
BEN 373..450 CDD:214981 7/29 (24%)
TIM_phosphate_binding 496..>581 CDD:304361
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.