DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and RHOXF2

DIOPT Version :10

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_115887.1 Gene:RHOXF2 / 84528 HGNCID:30011 Length:288 Species:Homo sapiens


Alignment Length:131 Identity:42/131 - (32%)
Similarity:57/131 - (43%) Gaps:33/131 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 GHQSDETGSGEGENSNGGASNI----------------GNTED-DQAR----------------L 465
            |.|..|...|.||..:||.:.:                ||.|| ||:.                |
Human    64 GAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSRPQGAVGGL 128

  Fly   466 ILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREE 530
            ......|.|..:||..|:..||:.|:|..:|..|.|.|||..:.:.|..:|:||.||||||||.:
Human   129 EPGNAQQPNVHAFTPLQLQELERIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQ 193

  Fly   531 K 531
            :
Human   194 R 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeodomain 473..528 CDD:459649 24/54 (44%)
RHOXF2NP_115887.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..136 15/71 (21%)
Homeodomain 139..191 CDD:459649 23/51 (45%)
PRK02287 <183..>232 CDD:235024 8/12 (67%)
Nuclear localization signal. /evidence=ECO:0000250 186..195 6/9 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.