DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and pax6

DIOPT Version :10

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_031755865.1 Gene:pax6 / 448447 XenbaseID:XB-GENE-484088 Length:469 Species:Xenopus tropicalis


Alignment Length:75 Identity:19/75 - (25%)
Similarity:28/75 - (37%) Gaps:22/75 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FFQPLGIIISIIFLLMHAASWSVICQQCLAGNEEVREIISIDFLENFGANSKSLPMLAAIYYLAG 99
            |.||||.|::   ..:|           |.|.|..|..:|        .||....:.|.::.|.|
 Frog   221 FRQPLGAIVA---GKLH-----------LCGAEGERSQVS--------TNSHVCLLWAWVHSLTG 263

  Fly   100 NISAHSILLL 109
            ..|..:..|:
 Frog   264 ASSCPAPYLI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645 3/12 (25%)
Homeodomain 473..528 CDD:459649
pax6XP_031755865.1 PAX 35..173 CDD:128645
Homeodomain 259..314 CDD:459649 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.