DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and shox

DIOPT Version :10

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_004911874.1 Gene:shox / 100486480 XenbaseID:XB-GENE-920752 Length:334 Species:Xenopus tropicalis


Alignment Length:155 Identity:54/155 - (34%)
Similarity:85/155 - (54%) Gaps:31/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 TAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGAS 453
            |..|....|.:|.:...||...::     :||     :||.||   |.:|   |.:.:..:.|::
 Frog    79 TGLARVRELGNSETNLQDITDTSN-----HCP-----LHLYKE---HGAD---SDKDKLKDYGST 127

  Fly   454 NIG-------------NTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLA 505
            .:.             .:||:..:..||::  |:||:||.:|::.||:.|:.|||||.|.||.|:
 Frog   128 RVSEGIYECKEKRDDVKSEDEDGQTKLKQR--RSRTNFTLEQLNELERLFDETHYPDAFMREELS 190

  Fly   506 GKIGLPEARIQVWFSNRRAKWRREE 530
            .::||.|||:||||.|||||.|::|
 Frog   191 QRLGLSEARVQVWFQNRRAKCRKQE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeodomain 473..528 CDD:459649 32/54 (59%)
shoxXP_004911874.1 Homeodomain 157..213 CDD:459649 32/57 (56%)
OAR 314..330 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.