DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mav and GDF5

Sequence 1:NP_524626.1 Gene:mav FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_000548.2 Gene:GDF5 HGNCID:4220 Length:501 Species:Homo sapiens

Alignment Length:231 Identity:53/232 (23%)
Similarity:100/232 (43%) Gaps:32/232 (14%)


  Fly   481 WIEFDVTKAVRSWLNKSHENLGIEIQC-DKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLN 544
            |..||:.|..|::.|.:  .|.:|::. ::.:::..|.|.        ...|:...|...:.:: 
Human   291 WEVFDIWKLFRNFKNSA--QLCLELEAWERGRAVDLRGLG--------FDRAARQVHEKALFLV- 344

  Fly   545 IIGHGTLNSQQHGDADIHQIMLTNNRSDQYVH-------HRSNHDSTWRKDKWTNNCYKLHQRCC 602
                  ....:..|...::|...:.:.|:.|:       .:.......|:.|..:.  .|..||.
Human   345 ------FGRTKKRDLFFNEIKARSGQDDKTVYEYLFSQRRKRRAPLATRQGKRPSK--NLKARCS 401

  Fly   603 RNQLDVAFKSIKGFEFILQPKVFDAGYCHGRC--PPR-HNPAHHHALLQSLIWQEDHKRAPRPCC 664
            |..|.|.||.:...::|:.|..::|.:|.|.|  |.| |....:||::|:|:...|.:..|..||
Human   402 RKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCC 466

  Fly   665 TPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            .|::|..:.||.:|.  ::.:....:.||.|..|.|
Human   467 VPTRLSPISILFIDS--ANNVVYKQYEDMVVESCGC 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 8/25 (32%)
TGF_beta 599..700 CDD:278448 33/104 (32%)
GDF5NP_000548.2 TGFb_propeptide 145..344 CDD:279078 12/63 (19%)
TGFB 400..501 CDD:214556 33/104 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11848
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.