DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mav and bmp7.2

Sequence 1:NP_524626.1 Gene:mav FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:XP_017947617.1 Gene:bmp7.2 XenbaseID:XB-GENE-855954 Length:436 Species:Xenopus tropicalis

Alignment Length:482 Identity:100/483 (21%)
Similarity:187/483 (39%) Gaps:140/483 (29%)


  Fly   283 YIEYLSRLRSNQEKGNSYFNNFMGASFTRDLHFLSITTNGFNDISNKRLR--HRRSLKK----IN 341
            ||. ||.:.||....|.:.::|:                      .:||:  .||.::|    |.
 Frog    30 YIS-LSSISSNTILENDFHSSFV----------------------QRRLKGHERREIQKEILTIL 71

  Fly   342 RLNQNPKKHQNYGDLLRGEQDTMNILLH--FPLTNAQDANFHHDKIDEANVRLMLLYSSSLATNF 404
            .|...|:.:      |..::.:..:.:.  :...|.:|.|  .:.:...|..:.|...|||||:.
 Frog    72 GLQHRPRPY------LPEKKKSAPLFMMDLYNAVNIEDLN--AEDVSYFNKPVSLNEHSSLATDQ 128

  Fly   405 RRGPGSRKNKISQISG---NDNIERHCN------------FGD--------VNLNQSNKNSSQQL 446
            .....:..:.:...:.   ||| |.:.|            .||        :..:....|.:.|:
 Frog   129 ENDFLAHADTVMSFANLVENDN-ELYKNRQKFKFDLTDIPLGDELTAAEFRIYKDYVENNETYQV 192

  Fly   447 TLKVYQLLSANRRR-----KITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGIEIQ 506
            |  |||:|.....:     ::.||.| :|      |...|:.||:|.....|:...|.|||::: 
 Frog   193 T--VYQVLQKQYDKEPYLFQVDSRTI-WG------TEKGWLTFDITATSNHWVINPHYNLGLQL- 247

  Fly   507 CDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTLNSQQHGDADIHQIMLTNNRS 571
                 ||.:..:...:|           .|:.|.             .::|..|....|:...::
 Frog   248 -----SIESMDMQSVNP-----------RHVGLF-------------GRNGPQDKQPFMVAFFKT 283

  Fly   572 DQYVHHRSNHDST---WRKDKWTNNCYK----------------------LHQRCCRNQLDVAFK 611
            .: :|.||...::   |.:::  ...||                      ..|.|.:::|.|:|:
 Frog   284 SE-IHLRSIRSTSNKHWNQER--AKTYKEQDNFPPANISDGIMPTAKRRFFKQACKKHELFVSFR 345

  Fly   612 SIKGFEFILQPKVFDAGYCHGRCPPRHNP---AHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLE 673
            .:...::|:.|:.:.|.||.|.|....|.   |.:||::|:|:...:.:..|:|||.|::|..:.
 Frog   346 DLGWQDWIIAPEGYAAYYCDGECAFPLNSFMNATNHAIVQTLVHFVNPETVPKPCCAPTQLNGIS 410

  Fly   674 ILHVDENHSDKLKISTWSDMQVVECAC 700
            :|:.|:  |..:.:..:.:|.|..|.|
 Frog   411 VLYFDD--SSNVILKKYKNMVVQACGC 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 20/69 (29%)
TGF_beta 599..700 CDD:278448 30/104 (29%)
bmp7.2XP_017947617.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.